Recombinant Human Augurin(ECRG4), partial

In Stock
Code CSB-EP887957HUa2
Abbreviation Recombinant Human ECRG4 protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
ECRG4
Uniprot No.
Research Area
Cancer
Alternative Names
Esophageal cancer-related gene 4 protein;ECRG4
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
71-132aa
Target Protein Sequence
QLWDRTRPEVQQWYQQFLYMGFDEAKFEDDITYWLNRDRNGHEYYGDYYQRHYDEDSAIGPR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
20.8 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Probable hormone that may attenuate cell proliferation and induce senescence of oligodendrocyte and neural precursor cells in the central nervous system. ECRG4-induced senescence is characterized by G1 arrest, RB1 dephosphorylation and accelerated CCND1 and CCND3 proteasomal degradation.
Gene References into Functions
  1. we have provided evidence to show that Ecrg4 is constitutively expressed in atria and the conduction systems and is down-regulated in AF. PMID: 28578429
  2. mutations in Pakistani patients with dilated cardiomyopathy rs375563861 (C2orf40), rs143187236 (MYOM3), and rs564181443 (RTKN2) have 3 fold or higher allele frequency in South Asians than in the global populations PMID: 29886034
  3. ECRG4 down-regulates UBE2C expression in esophageal squamous cell carcinoma cells. PMID: 29268240
  4. Results from many studies support the discovery that ECRG4 plays a critical role in the pathogenesis of atrial fibrillation. [review] PMID: 29126922
  5. UBR5 directly binds to the tumor suppressor esophageal cancer-related gene 4, increasing its ubiquitination to reducing the protein stability of ECRG4 to promote colorectal cancer progression. PMID: 28856538
  6. positive and negative regulatory elements controlling ECRG4 expression include a counter regulation between promoter methylation and Sp1 activation. PMID: 28870864
  7. the overexpression of Beclin 1 promoted apoptosis and decreased invasion by upregulating the expression of ECRG4 in A549 lung adenocarcinoma cells. Therefore, the selection of Beclin l as a target for gene therapy represents a more effective method for the treatment of lung cancer. PMID: 27175789
  8. Downregulated ECRG4 is correlated with lymph node metastasis in nasopharyngeal carcinoma PMID: 27119734
  9. The overexpression of ECRG4 inhibited tumorigenesis. PMID: 26762416
  10. ECRG4 may be a tumor suppressor in renal cancer and serve as a prognostic marker PMID: 26276361
  11. low expression or no expression of ECRG4 in esophageal cancer tissues was closely related to the degree of tumor invasion level, TNM staging, lymph node metastasis and recurrence and survival after surgery. PMID: 26823803
  12. loss of ECRG4 protein expression may be involved in tumor progression and may serve as a prognostic biomarker for breast cancer. PMID: 26631111
  13. Overexpression of ECRG4 inhibited laryngeal cancer cell proliferation and induced cancer cell apoptosis. PMID: 26165988
  14. Our data suggest that methylation-mediated suppression of the ECRG4 gene occurs frequently in nasopharyngeal carcinoma PMID: 25707757
  15. Results identify Ecrg4 as a paracrine factor that activates microglia and is chemotactic for monocytes, with potential as an antitumor therapeutic. PMID: 25378632
  16. ECRG4 is present on the surface of human monocytes and granulocytes and its interaction with the innate immunity receptor complex supports a role for cell surface activation of ECRG4 during inflammation PMID: 25511108
  17. The expression of ECRG4 is frequently upregulated in a papillary thyroid carcinoma through the demethylation mechanism of CpG islands in the gene promoter region, and the ECRG4 has a tumor-promoting function through inducing the cell cycle transition PMID: 25326809
  18. ECRG4 is a candidate tumor suppressor gene that might be involved in the proliferation of esophageal squamous cell carcinoma PMID: 23957914
  19. results suggest that C2ORF40 acts as a tumor suppressor gene in breast cancer pathogenesis and progression and is a candidate prognostic marker for this disease PMID: 23770814
  20. overexpression of ECRG4 enhanced the chemosensitivity of gastric cancer SGC-7901 cells to 5-FU through induction of apoptosis. PMID: 23553029
  21. Aberrant DNA methylation of ECRG4 gene is associated with colorectal cancer. PMID: 22901147
  22. Aberrant ECRG4 promoter methylation may be used to monitor early gastric cancer and predict pathological staging. PMID: 22626786
  23. DNA methylation of the ECRG4 promoter causes loss of ECRG4 gene expression in the esophageal squamous cell carcinoma cell line EC9706. PMID: 22325214
  24. kDa Ecrg4 localizes to the cell surface of prostate (PC3) or kidney (HEK) epithelial cells after transfection. PMID: 22526622
  25. Tumor necrosis factor-alpha-induced apoptosis was also suppressed in ECRG4-overexpressing Jurkat cells. PMID: 22411956
  26. ECRG4 is a candidate tumor suppressor gene in breast cancer PMID: 22110708
  27. Augurin would play a constitutive inhibitory function in normal CNS while down regulation of Ecrg4 gene expression in injury, like in cancer, dysinhibits proliferation. PMID: 21935431
  28. Data show that ECRG4 interacts directly with ECRG1 to upregulate p21 protein expression, induce cell cycle G1 phase block and inhibit cancer cells proliferation in ESCC. PMID: 21288367
  29. Loss of ECRG4 is associated with glioma. PMID: 20598162
  30. ECRG4 is silenced via promoter hypermethylation in different types of human cancer cells. PMID: 20017917
  31. Inactivation of ECRG 4 gene by hypermethylation is a frequent molecular event in esophageal squamous cell carcinoma and may be involved in the carcinogenesis of this cancer. PMID: 12800218
  32. Significantly lower expression of esophageal cancer-related gene 4 is associated with esophageal squamous cell carcinoma PMID: 17786363
  33. The restoration of ECRG4 expression in ESCC cells inhibited cell proliferation, colony formation, cell cycle progression and tumor growth in vivo. ECRG4 is a novel candidate tumor suppressor gene in ESCC. PMID: 19521989

Show More

Hide All

Subcellular Location
Secreted. Cytoplasm. Apical cell membrane.
Protein Families
Augurin family
Tissue Specificity
Expressed in the brain, with expression in the epithelial cell layer of the choroid plexus (at protein level).
Database Links

HGNC: 24642

OMIM: 611752

KEGG: hsa:84417

UniGene: Hs.43125

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*