Recombinant Human Autophagy-related protein 16-1 (ATG16L1)

Code CSB-EP734569HU
Abbreviation Recombinant Human ATG16L1 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
A16L1_HUMAN; APG16 like 1; APG16-like 1; APG16L; APG16L beta; ATG16 autophagy related 16 like 1; ATG16 autophagy related 16-like 1 (S. cerevisiae); ATG16A; ATG16L; Atg16l1; Autophagy related protein 16 1; Autophagy-related protein 16-1; FLJ00045; FLJ10035; FLJ10828; FLJ22677; IBD10; OTTHUMP00000164391; OTTHUMP00000164393; OTTHUMP00000165876; OTTHUMP00000165877; WD repeat domain 30; WDR30
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-607aa
Target Protein Sequence
MSSGLRAADFPRWKRHISEQLRRRDRLQRQAFEEIILQYNKLLEKSDLHSVLAQKLQAEKHDVPNRHEISPGHDGTWNDNQLQEMAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQRKDREMQMNEAKIAECLQTISDLETECLDLRTKLCDLERANQTLKDEYDALQITFTALEGKLRKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDTHPGSGKEVRVPATALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRSESIVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAIKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYIWSVLTGKVEKVLSKQHSSSINAVAWSPSGSHVVSVDKGCKAVLWAQY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
84.3kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays an essential role in autophagy: interacts with ATG12-ATG5 to mediate the conjugation of phosphatidylethanolamine (PE) to LC3 (MAP1LC3A, MAP1LC3B or MAP1LC3C), to produce a membrane-bound activated form of LC3 named LC3-II. Thereby, controls the elongation of the nascent autophagosomal membrane. Regulates mitochondrial antiviral signaling (MAVS)-dependent type I interferon (IFN-I) production. Negatively regulates NOD1- and NOD2-driven inflammatory cytokine response. Instead, promotes with NOD2 an autophagy-dependent antibacterial pathway. Plays a role in regulating morphology and function of Paneth cell.
Gene References into Functions
  1. genetic associations studies conducted in population of postmenopausal women in Brazil: Data suggest that a genetic polymorphism in ATG16L1 (T300A) is associated with cardiovascular disease in postmenopausal women in the population studied (after adjustments for confounding variables). PMID: 30236831
  2. show that the WD repeat-containing C-terminal domain (WD40 CTD) of ATG16L1 is essential for LC3 recruitment to endolysosomal membranes during non-canonical autophagy PMID: 29317426
  3. the role of the autophagy elongation complex (ATG5-12/16L1) in Hepatitis C virus replication and membranous web formation, was examined. PMID: 28067309
  4. The association of ATG16L1 to Crohn's disease in Iranian patients was confirmed while it was shown that the studied polymorphisms in IRGM was not associated with Crohn's disease. PMID: 29960072
  5. T300A polymorphism alters the function of motif-containing molecules that engage ATG16L1 through the WD40 domain PMID: 27273576
  6. Two SNPs (rs4663421 and rs6758317) and the TT haplotype of the ATG16L1 gene are possibly associated with ankylosing spondylitis susceptibility in a Chinese Han female population. PMID: 28952203
  7. the ATG16L1 genotype was significantly associated with the risk of developing Crohn's disease. PMID: 27698206
  8. The identification, purification, biochemical characterization and crystallization of the proteolytically stable ATG16L1 subfragment, 72-307, are reported here. PMID: 28994404
  9. Our results suggest that these three genes that are critical components of the autophagy pathway (ATG16L, ATG2B, ATG5) are not significant risk factors among Spanish patients with either pseudoexfoliation syndrome or pseudoexfoliation glaucoma. PMID: 27960588
  10. TMEM74 promotes tumor cell survival by inducing autophagy via interactions with ATG16L1 and ATG9A. PMID: 29048433
  11. HBV gained access to Atg5-12/16L1 via interaction of its core protein with the Atg12 moiety of the complex. In contrast, subsequent autophagosome maturation and closure events were unnecessary for HBV replication, as evidenced by inhibition of Atg8/LC3 conjugation. Interfering with the HBV/Atg12 cross talk may be a tool for virus control. PMID: 29367244
  12. genetic variations in ATG16L1 can predict brain metastasis (BM) and that genome analysis would facilitate stratification of patients for BM prevention trials. PMID: 28441070
  13. transient expression of ATG16L1 not only inhibited autophagosome biogenesis, but also aberrantly targeted RAB11-positive recycling endosomes, resulting in recycling endosome aggregates. PMID: 27875067
  14. the ATG16L1 (T300A) variant is associated with necrotizing enterocolitis in premature infants PMID: 27893720
  15. this study shows that the association between ATG16L1 and Crohn's disease is mediated at least in part through Rac1 hyperactivation and subsequent defective dendritic cell migration PMID: 27435106
  16. the data suggested that genetic variants within the ATG16L1 gene promoter were not a risk factor for sporadic Parkinson's disease development PMID: 28279708
  17. Polymorphism in ATG16L1 gene is associated withinflammatory bowel disease. PMID: 28542425
  18. EVA1A interacts with the WD repeats of ATG16L1 through its C-terminal and promotes ATG12-ATG5/ATG16L1 complex recruitment to the autophagic membrane and enhances the formation of the autophagosome. PMID: 27490928
  19. Identified and present structure of the predicted WD40 domain boundaries of the autophagy-related protein 16-1 (ATG16L1). PMID: 28685931
  20. this study revealed that ATG16L1 deficiency led to alterations in macrophage function that contribute to the severity of Crohn disease PMID: 28130498
  21. The present results support the hypothesis that Trimethylamine N-oxide may be involved in the pathogenesis of inflammatory bowel disease by impacting ATG16L1-induced autophagy and activating NLRP3 inflammasome. PMID: 28629999
  22. MicroRNA-410 regulates autophagy-related gene ATG16L1 expression and enhances chemosensitivity via autophagy inhibition in osteosarcoma.( PMID: 28138700
  23. we focus on the contributions of the plasma membrane to autophagosome biogenesis governed by ATG16L1 and ATG9A trafficking, and summarize the physiological and pathological implications of this macroautophagy route, from development and stem cell fate to neurodegeneration and cancer. PMID: 27758042
  24. ATG16L1 T300A Polymorphism is Correlated with Gastric Cancer Susceptibility. PMID: 26547861
  25. Induction of Anti-TNF induced macrophages is impaired in donors carrying the T300A risk allele for the ATG16L1 suggesting that an intact autophagy pathway may be important for an optimal response to anti-TNF therapy in inflammatory bowel disease. PMID: 26417049
  26. The Egr-1 and Atg16L1 genes' polymorphisms were significant risk factors for susceptibility to chronic obstructive pulmonary disease (COPD) . These results demonstrate that autophagy regulator genetic mutations are associated with COPD in male smokers. PMID: 24012056
  27. Subjects homozygous for the autophagy-related 16-like protein (ATG16L1) CD-associated gene variant (rs2241880), had low SHIP mRNA expression and activity. PMID: 26226011
  28. The Thr300Ala variant in ATG16L1 is associated with improved survival in human colorectal cancer and enhanced production of type I interferon. PMID: 25645662
  29. ATG16L1 as a bona fide physiological CSNK2 and PPP1 substrate, which reveals a novel molecular link from CSNK2 to activation of the autophagy-specific ATG12-ATG5-ATG16L1 complex and autophagy induction PMID: 26083323
  30. Knockdown of Atg16L1, a crucial autophagy gene, leads to developmental retention of early-stage cells in various tissues where the differentiation of stem cells is retarded. PMID: 26837467
  31. Antibacterial autophagy is impaired in CLEC12A-deficient cells, and this effect is exacerbated in the presence of the ATG16L1( *)300A risk allele. PMID: 26095365
  32. ATG16L1 may be used as a biomarker for selecting oral squamous cell carcinoma patients with a more aggressive phenotype. PMID: 25060858
  33. CNTNAP3 could upregulate the expression of ATG16L1 and increase autophagy vacuoles PMID: 25883416
  34. decreased expression in colon biopsies of Crohn's disease patients; conversely, increased expression in ulcerative colitis patients PMID: 25886994
  35. ATG16L1 variant rs2241880 was associated with 38% increase in the risk for Crohn's disease for higher mutational load, whereas IL23R variant rs11209026 decreased the risk by 54% for higher mutational load. PMID: 25738374
  36. CD patients homozygous for the ATG16L1-T300A risk allele show impaired clearance of pathosymbionts in ileal inflammation indicating that ATG16L1 is essential for effective elimination of pathosymbionts upon inflammation. PMID: 25253126
  37. genotyped 31 Crohn's disease (CD)-associated genes in 102 Slovenian patients. The strongest association for treatment response defined as decrease in CRP levels was found for ATG16L1 SNP rs10210302. PMID: 25712183
  38. These two steps are essential for the maturation of small single-membrane autophagic precursors containing ATG16L1 and mATG9 proteins into double-membrane autophagosomes PMID: 25461811
  39. The signaling axis of HIF-1a, miR-20a-5p, and ATG16L1 in autophagic process might be a critical adapting mechanism for ischemic kidney injury. PMID: 26165754
  40. ATG16L1 gene does play a role in the pathogenesis of Crohn's Disease in the Chinese population. PMID: 25048429
  41. ATG16L1 expression could influence vascular endothelial function during atherogenesis. PMID: 25767270
  42. Data suggest ATG16L1 dimer interacts with WIPI2b (WD repeat domain phosphoinositide-interacting protein 2) and this interaction is linked to phosphatidylinositol 3-phosphate production in endoplasmic reticulum and autophagosome formation. [REVIEW] PMID: 25233411
  43. results showed that the prevalence of ATG16L1 and IL23R variants was not significantly different between patients and controls. However a possible role of ATG16L1 (T300A) on CD phenotype was suggested PMID: 25159710
  44. Subjects carrying GG genotype were at a higher risk for colorectal cancer (OR 1.99, 95% CI: 1.02-3.91, p=0.039) when compared with the more frequent AA genotype. PMID: 24715166
  45. Monocytes of Crohn's disease patients show enhanced phagocytosis associated with the presence of ATG16L1 and NOD2 variants. PMID: 24627602
  46. MIR142-3p, upon transient overexpression in the cells, resulted in decreased ATG16L1 mRNA and protein levels PMID: 24401604
  47. Carriage of the minor A allele of ATG16L1 was associated with septic shock with at least one organ failure (odds ratio (OR): 2.40, p: 0.036). PMID: 24791954
  48. this is the first paediatric study reporting an association between the presence of the rs2241880 risk polymorphism of ATG16L1 in children with CD and a more severe phenotype of the disease. PMID: 24656308
  49. The frequency of the allele G of the polymorphism T300A was higher in the group of patients with Crohn's disease (48.6%) than in controls (42.4%), although not reaching statistical significance. PMID: 25003259
  50. Letter: ATG16L1 rs2241880 genetic polymorphism does not confer predisposition to rheumatoid arthritis. PMID: 23535819

Show More

Hide All

Involvement in disease
Inflammatory bowel disease 10 (IBD10)
Subcellular Location
Cytoplasm. Preautophagosomal structure membrane; Peripheral membrane protein.
Protein Families
WD repeat ATG16 family
Database Links

HGNC: 21498

OMIM: 610767

KEGG: hsa:55054

STRING: 9606.ENSP00000375872

UniGene: Hs.529322

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*