Recombinant Human Azurocidin (AZU1)

Code CSB-YP002485HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP002485HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP002485HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP002485HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP002485HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
Azurocidin; Cationic antimicrobial protein CAP37; Heparin-binding protein; HBP; hHBP; AZU1
Species
Homo sapiens (Human)
Expression Region
27-248
Target Protein Sequence
IVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTAASCFQSQNPGVSTVVLGAYDLRRRERQSRQTFSISSMSENGYDPQQNLNDLMLLQLDREANLTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSGGRLSRFPRFVNVTVTPEDQCRPNNVCTGVLTRRGGICNGDGGTPLVCEGLAHGVASFSLGPCGRGPDFFTRVALFRDWIDGVLNNPGP
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This is a neutrophil granule-derived antibacterial and monocyte- and fibroblast-specific chemotactic glycoprotein. Binds heparin. The cytotoxic action is limited to many species of Gram-negative bacteria; this specificity may be explained by a strong affinity of the very basic N-terminal half for the negatively charged lipopolysaccharides that are unique to the Gram-negative bacterial outer envelope. It may play a role in mediating recruitment of monocytes in the second wave of inflammation. Has antibacterial activity against the Gram-negative bacterium P.aeruginosa, this activity is inhibited by LPS from P.aeruginosa. Acting alone, it does not have antimicrobial activity against the Gram-negative bacteria A.actinomycetemcomitans ATCC 29532, A.actinomycetemcomitans NCTC 9709, A.actinomycetemcomitans FDC-Y4, H.aphrophilus ATCC 13252, E.corrodens ATCC 23834, C.sputigena ATCC 33123, Capnocytophaga sp ATCC 33124, Capnocytophaga sp ATCC 27872 or E.coli ML-35. Has antibacterial activity against C.sputigena ATCC 33123 when acting synergistically with either elastase or cathepsin G.
Gene References into Functions
  1. Neuronal CAP37 may modulate the neuroinflammatory response in Alzheimer disease. PMID: 26170148
  2. Plasma levels of heparin-binding protein were significantly higher in patients with acute respiratory distress syndrome. PMID: 23883488
  3. identified a multifunctional bioactive peptide, based on CAP37, that induces cell migration, possesses antibacterial and LPS-binding activity, and is effective at healing infected and noninfected corneal wounds in vivo. PMID: 25412625
  4. Azurocidin 1 displays antimicrobial activity against E. coli, S. faecalis, and C. albicans. PMID: 11994286
  5. Low levels of azurocidin in maternal serum in the first trimester were associated with subsequent preterm prelabor rupture of membranes. PMID: 23808364
  6. AZU1 exhibited high affinity binding to PTX3 in a calcium ion-dependent manner PMID: 22278372
  7. Heparin-binding protein is elevated in patients with shock from septic and non-septic etiologies. PMID: 22207392
  8. The TAASC motif in a cyclizised 20-44 amino acid peptide is part of the ligand in HBP responsible for activation of the HBP receptor on monocytes. Monocytes release HBP constitutively in small amounts and more so in the presence of lipopolysaccharide. PMID: 20083497
  9. Proliferating bile ductules may play a role in the inflammatory response in biliary atresia through expression of CAP37. PMID: 20399025
  10. group A streptococci induce contact activation and HBP release during skin infection, which likely contribute to the symptoms seen in erysipelas: fever, pain, erythema, and edema PMID: 20107486
  11. Secretion of heparin-binding protein (CAP37) from human neutrophils is determined by its localization in azurophilic granules and secretory vesicles PMID: 11861296
  12. CAP37 is localized within the vascular endothelium associated with atherosclerotic plaques. CAP37 is induced in endothelial cells in response to inflammatory mediators PMID: 11891183
  13. structural analysis of N-glycans PMID: 12054586
  14. A comparison of proforms and mature forms of azurocidin in regulating granulopoiesis PMID: 12135665
  15. arginine-rich residues of CAP37 amplify lipopolysaccharide-induced monocyte activation PMID: 12438368
  16. CAP37 is a neutrophil-derived inflammatory mediator that augments leukocyte adhesion to endothelial monolayers PMID: 12826073
  17. Azurocidin 1 (cationic antimicrobial protein 37)is a multifunctional inflammatory mediator causing an increase of vascular permeability [review]. PMID: 14515154
  18. Due to its localization to atherosclerotic plaques and its ability to modulate smooth muscle cells, CAP37 may play a role in the progression of this disease. PMID: 15020208
  19. Secretion of CAP37, a neutrophil granule protein accumulating on the endothelial cell surface and promoting arrest of monocytes, could contribute to the recruitment of monocytes at inflammatory loci. PMID: 15879141
  20. HBP appears to be one of the primary effector molecules of antibody-mediated nonhemolytic transfusion reactions including transfusion acute lung injury PMID: 18346022
  21. HBP and human neutrophil peptides 1-3 triggered macrophage release of TNF-alpha and IFN-gamma, which acted in an autocrine loop to enhance expression of CD32 and CD64 and thereby enhance phagocytosis[heparin-binding protein, HBP] PMID: 18787642
  22. Data show that human neutrophils challenged with leukotriene B(4) release heparin-binding protein as determined by Western blot analysis. PMID: 19151333

Show More

Hide All

Subcellular Location
Cytoplasmic granule membrane; Peripheral membrane protein; Cytoplasmic side.
Protein Families
Peptidase S1 family, Elastase subfamily
Database Links

HGNC: 913

OMIM: 162815

KEGG: hsa:566

STRING: 9606.ENSP00000233997

UniGene: Hs.72885

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1