Recombinant Human Bactericidal permeability-increasing protein (BPI), partial

In Stock
Code CSB-EP002783HU2
Abbreviation Recombinant Human BPI protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Immunology
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
281-487aa
Target Protein Sequence
HDRMVYLGLSDYFFNTAGLVYQEAGVLKMTLRDDMIPKESKFRLTTKFFGTFLPEVAKKFPNMKIQIHVSASTPPHLSVQPTGLTFYPAVDVQAFAVLPNSSLASLFLIGMHTTGSMEVSAESNRLVGELKLDRLLLELKHSNIGPFPVELLQDIMNYIVPILVLPRVNEKLQKGFPLPTPARVQLYNVVLQPHQNFLLFGADVVYK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
30.2 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
The cytotoxic action of BPI is limited to many species of Gram-negative bacteria; this specificity may be explained by a strong affinity of the very basic N-terminal half for the negatively charged lipopolysaccharides that are unique to the Gram-negative bacterial outer envelope. Has antibacterial activity against the Gram-negative bacterium P.aeruginosa, this activity is inhibited by LPS from P.aeruginosa.
Gene References into Functions
  1. BPI G645A polymorphism was associated with a decreased risk of ulcerative colitis; the BPI G645A polymorphism was not associated with the risk of crohn's disease. PMID: 28035462
  2. Bactericidal permeability increasing protein Lys216Glu polymorphism is associated with both Crohn's disease and ulcerative colitis. PMID: 26228368
  3. MPO and BPI in CD4(+)T-lymphocytes, and PDHA1 and MRPL42 in CD8(+) T-lymphocytes might be used as specific biomarkers of severe asthma progression. PMID: 26107902
  4. This review article focuses on the structural and functional properties of BPI with respect to its antimicrobial contribution to host defense during GNB infections and endotoxin-induced inflammation. PMID: 17678885
  5. Diminished PRRs, IFN-signature, and BPI gene expression raises the possibility that impairments in these pathways contribute to the susceptibility of LBW term infants to infection. PMID: 23626859
  6. Lung function and IgA-BPI-ANCA, but not Leeds criteria, were significantly associated with adverse outcome. PMID: 23346184
  7. BPI mutation (PstI in intron 5) and a decreased plasma BPI level were significant risk factors in susceptibility to COPD...BPI genetic mutation and impaired BPI production or release may result in airflow obstruction in smokers. PMID: 22409502
  8. The bactericidal/permeability-increasing protein in the innate defence of the lower airways PMID: 21787345
  9. there is a correlation between the presence of BPI-ANCA, the properties of the colonizing bacteria and the clinical conditions of the host in cystic fibrosis PMID: 21463973
  10. SNP Lys216Glu is associated with Crohn's disease and ulcerative colities PMID: 21272798
  11. Restriction enzyme digestion and DNA sequence analysis revealed that the sequence encoding signal peptide and bioactive N-terminal fragment of BPI had six nucleotide substitutions, compared with that of the established human BPI sequence PMID: 17488601
  12. BPI is the main target antigen for ANCA in tuberculosis and BPI-ANCA increase after treatment PMID: 20412700
  13. Circulating BPI could constitute a biomarker of lipid metabolism in subjects with normal glucose tolerance and could help to identify those subjects with preserved endothelial function. PMID: 20174761
  14. Investigated if serum and salivary anti-BPI autoantibodies appear in the course of acute pneumonia. Presence of anti-BPI IgG on admission didn't correlate with inflammatory markers. Salivary anti-BPI IgA didn't appear during the course of acute pneumonia. PMID: 19702878
  15. Lipid mediator-induced expression of bactericidal/ permeability-increasing protein (BPI) in human mucosal epithelia PMID: 11891303
  16. increased levels in fetal disease, premature rupture of membranes, and preterm labor PMID: 12710851
  17. Constitutive expression of BPI, which increases upon interleukin 4 stimulation, by human dermal fibroblast was demonstrated, suggesting an important role of BPI in gram-negative bacterial clearance and a dampened response to endotoxin in the skin PMID: 12738651
  18. BPI and cathepsin G are the major antigenic targets of ANCA seen in patients with systemic sclerosis PMID: 12784398
  19. BPI and HNP are accumulated in the synovial cavity of patients with rheumatoid arthritis PMID: 12913926
  20. In conclusion, we provide evidence for AML-1, PU.1, and Sp3 cooperatively and directly mediating BPI-expression during myeloid differentiation. PMID: 14623259
  21. BPI could exist in the inner root sheath cells of human and rat hair follicles, and might play a role as a barrier against anaerobic bacteria PMID: 15009116
  22. The BPI stored in human neutrophil granulocytes, is cytotoxic against Gram-negative bacteria. PMID: 15590754
  23. The bactericidal/permeability increasing protein (BPI) is involved in the elimination of gram-negative bacteria. A functionally relevant single nucleotide polymorphism of the BPI gene causes an amino acid exchange (Glu216Lys). PMID: 15758620
  24. Studies of BPI promoter expression in intestinal epithelial cells identified regulatory regions of the BPI promoter and revealed a prominent role for CCAAT/enhancer binding protein and especially Sp1/Sp3 in the basal regulation of BPI. PMID: 16282362
  25. findings suggest that BPI is associated with metabolic pathways PMID: 16380496
  26. BPI that is functionally active against mucoid P. aeruginosa strains is expressed in the airways of Cystic Fibrosis patients but may be hampered by autoantibodies, resulting in chronic infection. PMID: 16861658
  27. The present study does not give evidence for the contribution of the BPI gene to the genetic background of chronic periodontal disease. PMID: 16893388
  28. BPI has unusual dual properties of promoting retinal pericytes and retinal pigment epithelial cell growth while suppressing VEGF-induced retinal epithelial cell growth and vascular permeability PMID: 17012258
  29. Reduces expression of type I inetrferon by antagonizing lipopolysaccharide-binding protein. PMID: 17239348
  30. the requirement for C/EBP epsilon in mediating BPI gene expression in myeloid cells in vitro and in vivo. PMID: 17483073
  31. a novel role of BPI in the interaction of bacterial outer membrane vesicles with dendritic cells that may help link innate immune recognition of endotoxin to Ag delivery and presentation. PMID: 17675509
  32. evaluated the role of genetic polymorphisms of the bactericidal permeability increasing protein (BPI) in pediatric patients with sepsis PMID: 17898994

Show More

Hide All

Subcellular Location
Secreted. Cytoplasmic granule membrane.
Protein Families
BPI/LBP/Plunc superfamily, BPI/LBP family
Tissue Specificity
Restricted to cells of the myeloid series.
Database Links

HGNC: 1095

OMIM: 109195

KEGG: hsa:671

STRING: 9606.ENSP00000262865

UniGene: Hs.529019

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*