Recombinant Human Bile salt export pump (ABCB11), partial

Code CSB-EP001049HU1
Abbreviation Recombinant Human ABCB11 protein, partial
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cancer
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1036-1256aa
Target Protein Sequence
SYTPSYAKAKISAARFFQLLDRQPPISVYNTAGEKWDNFQGKIDFVDCKFTYPSRPDSQVLNGLSVSISPGQTLAFVGSSGCGKSTSIQLLERFYDPDQGKVMIDGHDSKKVNVQFLRSNIGIVSQEPVLFACSIMDNIKYGDNTKEIPMERVIAAAKQAQLHDFVMSLPEKYETNVGSQGSQLSRGEKQRIAIARAIVRDPKILLLDEATSALDTESEKT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
31.3 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the transport of the major hydrophobic bile salts, such as taurine and glycine-conjugated cholic acid across the canalicular membrane of hepatocytes in an ATP-dependent manner, therefore participates in hepatic bile acid homeostasis and consequently to lipid homeostasis through regulation of biliary lipid secretion in a bile salts dependent manner. Transports taurine-conjugated bile salts more rapidly than glycine-conjugated bile salts. Also transports non-bile acid compounds, such as pravastatin and fexofenadine in an ATP-dependent manner and may be involved in their biliary excretion.
Gene References into Functions
  1. We concluded that Egyptian patients having chronic hepatitis C genotype 4 with CC genotype of ABCB11 SNP 1331T>C and high plasma bile acid levels at cutoff value of 75.5 mumol/L were associated with advanced hepatic fibrosis. PMID: 29755014
  2. The overrepresentation of mutated variants of the 1331T > C ABCB11 polymorphism in the ICP group suggests its contribution to the etiology of the intrahepatic cholestasis of pregnancy. Analysis of genotypes' co-existence pointed to the possibility of the mutated variants of polymorphism 1954A > G ABCB4 and 1331T > C ABCB11 having a summation effect on the development ofintrahepatic cholestasis of pregnancy PMID: 30091450
  3. These data demonstrated that c.386G>A (p.C129Y) in ABCB11 was a causative mutation that correlated with the phenotype of patients with PFIC2, the impairment of biliary excretion into bile canaliculi, and the absence of canalicular BSEP expression in liver histological assessments. PMID: 29507376
  4. FIC1, BSEP, and MDR3 represent hepatobiliary transport proteins essential for bile formation. PMID: 28733223
  5. This is the first report on a diagnostic test for simultaneous genotyping of IFNL3, ABCB11, and RNF7 in Chronic hepatitis C (CHC) patients. Reliable and inexpensive, the assay should provide useful information for the clinical management of CHC, like identification of patients at risk of rapid disease progression or with high chances of response to classic therapy. PMID: 28860020
  6. Residual function of BSEP as well as substrate specificity influence the therapeutic effectiveness of partial external biliary diversion in progressive familial intrahepatic cholestasis type 2. PMID: 28839429
  7. Study suggested that the CC genotype of rs2287616 variant of ABCB11 gene might contribute to anti-tuberculosis drug-induced cholestatic liver injury in Chinese patients. PMID: 27293027
  8. Case Report: compound heterozygotes for two missense mutations of the ABCB11 with a mild form of progressive familial intrahepatic cholestasis type 2. PMID: 28425419
  9. Patients with a confirmed ABCB11 or tight junction protein 2 gene mutation (n = 7) had a minimally detectable THBA proportion (0.23-2.99% of total BAs). Three patients with an ATP8B1 mutation had an elevated THBA proportion (7.51-37.26%). PMID: 28073941
  10. By these complementary approaches, a set of ten novel BSEP interaction partners was identified. With the exception of radixin, all other interaction partners were integral or membrane-associated proteins including proteins of the early secretory pathway and the bile acyl-CoA synthetase, the second to last, ER-associated enzyme of bile salt synthesis PMID: 27472061
  11. Report ABAB11 missense mutations in Korean infants with progressive familial intrahepatic cholestasis. PMID: 27239116
  12. Among the Han individuals aged over 40 years in Hunan, China, genotype CC or CT of BSEP gene SNP rs2287622 may correlate with higher risk of chronic hepatitis C in comparison with genotype TT. PMID: 28292275
  13. Case Reports: late onset progressive familial intrahepatic cholestasis 2 secondary to novel ABCB11 mutations. PMID: 27493120
  14. Negative immunoreaction of BSEP was found in the majority of the progressive familial intrahepatic cholestasis (PFIC) group. Nonetheless, the negative immunoreaction was demonstrated in a considerable number of the non-PFIC group.BSEP immunoreaction was negative in the majority (82.4%) of PFIC2 but in none of the two patients with PFIC1. PMID: 26845599
  15. The results revealed that functional impairment of BSEP predisposes the cells to altered BA disposition and is a susceptive factor to drug-induced cholestatic injury. PMID: 26910619
  16. Results identified six novel mutations (PKHD1: p.Thr777Met, p.Tyr2260Cys; ABCB11: p.Val1112Phe, c.611+1G > A, p.Gly628Trpfs*3 and NPC1: p.Glu391Lys) for the diagnostic of inherited infantile cholestatic disorders. PMID: 25771912
  17. Report highly specific expression of BSEP and MDR3 in hepatocellular carcinoma. PMID: 26735860
  18. GGT levels in patients with ATP8B1 or ABCB11 deficiency varied with age. The peak GGT value was <70U/L in the 2nd~6th month of life, <60U/L in the 7th~12th month and <50U/L beyond one year PMID: 27050426
  19. methods that can be used to assess and quantify BSEP inhibition, and key gaps in our current understanding of the relationship between this process and DILI, are discussed PMID: 25104267
  20. Liver nuclear receptors, FXR and SHP, and bile acid transporters, NTCP and BSEP, are associated with the progression of NAFLD. PMID: 26019035
  21. ABCB11 444A had slightly reduced transport activity. PMID: 25713208
  22. Similar molecular features between MRP4 and BSEP inhibitors may partially explain why various drugs have affinity for both transporters. PMID: 25735837
  23. In malignant tumours in the liver, BSEP marking was 100% specific and 90% sensitive for hepatocellular carcinoma. PMID: 25378077
  24. The aim of this study was the evaluation of some single nucleotide polymorphisms of genes (ABCB1, SLC28A2/3, SLC29A1) involved in telaprevir (TLV) and ribavirin transport and their correlation with plasma TLV drug exposure at 1 month of therapy. PMID: 25661339
  25. Aberrant splicing of ABCB11 in the liver of progressive familial intrahepatic cholestasis type 2 patients. PMID: 25085279
  26. Variants of ABCB11 were not associated with bosentan-induced liver injury. PMID: 25332267
  27. analysis of mutations in ABCB11 gene in children with intrahepatic cholestasis PMID: 24969679
  28. BSEP rs473351 was closely associated with the susceptibility of primary biliary cirrhosis and resistance to ursodeoxycholic acid treatment. PMID: 25392597
  29. expression in hepatocytes repressed by estradiol PMID: 24729004
  30. Our data suggest that in addition to functional inhibition, repression of bile salt export pump expression may play an important role in drug-induced cholestatic liver toxicity. PMID: 24335466
  31. Patients carrying the C allele in the ABCB11 1331T>C polymorphism are at increased risk of developing hepatocellular type of DILI, when taking drugs containing a carbocyclic system with aromatic rings PMID: 23701583
  32. Cholesterol increases the transport rates of ABCB11 and ABCC2, but with the latter, may also modify the binding site as for E17betaG PMID: 24711118
  33. The novel missense mutation G374S impairs transport function without disabling membrane localization of BSEP, causing a transitional phenotype between benign recurrent and progressive familial intrahepatic cholestasis . PMID: 23758865
  34. FXR regulates BSEP in an isoform-dependent and species-specific manner PMID: 24002920
  35. The introduction of a Y1311A mutation into BSEP. PMID: 24378332
  36. Six single nucleotide polymorphisms in ABCB11 that showed significant evidence of association were identified. PMID: 24366234
  37. Case Report: suggest contribution of ATP8B1 mutations to drug-induced liver injury from anabolic androgenic steroids marketed as dietary supplements. PMID: 23750872
  38. This review describes the molecular characteristics and physiological roles of BSEP, the trafficking and sorting machinery of BSEP, and the mechanisms responsible for disturbance of BSEP, which causes intrahepatic cholestasis. [review] PMID: 23876151
  39. Approximately 3% of TNC cases can be attributed to ABCB11 mutations. PMID: 23279303
  40. Inhibition of Bsep mRNA expression is regulated by loss of T cells but not B cells, in immune-mediated liver disease. PMID: 23929842
  41. Genotyping of Italian women revealed 3 novel variants of ABCB11 (p.V284D, p.Q558H, p.P731S) associated with intrahepatic cholestasis of pregnancy. PMID: 23022423
  42. Troglitazone specifically inhibits human MRP2 and BSEP in PXB mouse chimeric liver. PMID: 22673116
  43. The data confirmed that homozygous presence of the major [C] allele of ABCB11 c.1331 T>C is a genetic susceptibility factor for hepatitis C infection, but not for liver fibrosis. PMID: 22681771
  44. constitutive internalization of BSEP is clathrin-mediated and dependent on the tyrosine-based endocytic motif at the C-terminal end of BSEP. PMID: 22161577
  45. Patients undergoing partial hepatectomy with low post-operative bilirubin had lower levels of NTCP, MDR3 and BSEP mRNA compared to those with high bilirubin after Pringle manoeuvre. PMID: 22098322
  46. The higher allelic frequency of ABCB11 1331C in HCV-patients compared to controls may indirectly link increased bile acids to hepatitis C virus chronicity. PMID: 20723035
  47. Here we report the first case of a patient with combined hereditary spherocytosis and compound heterozygous ABCB11 gene variants predisposing to intrahepatic cholestasis PMID: 21811948
  48. A spectrum of BSEP-dependent effects on the course of liver diseases, and two mutations that differentially affect total bile acid output and the biliary bile acid profile, are described. PMID: 21691112
  49. Sequencing of the ABCB11 gene revealed two new ABCB11 mutations responsible for type 2 benign recurrent intrahepatic cholestasis in a French-Canadian family. PMID: 21766090
  50. Mutations ending ABCB11 transcription appear linked, through hepatocellular necrosis and fibrosis, to worse outcome PMID: 21490445

Show More

Hide All

Involvement in disease
Cholestasis, progressive familial intrahepatic, 2 (PFIC2); Cholestasis, benign recurrent intrahepatic, 2 (BRIC2)
Subcellular Location
Apical cell membrane; Multi-pass membrane protein. Recycling endosome membrane; Multi-pass membrane protein. Endosome. Cell membrane; Multi-pass membrane protein.
Protein Families
ABC transporter superfamily, ABCB family, Multidrug resistance exporter (TC 3.A.1.201) subfamily
Tissue Specificity
Expressed predominantly, if not exclusively in the liver, where it was further localized to the canalicular microvilli and to subcanalicular vesicles of the hepatocytes by in situ.
Database Links

HGNC: 42

OMIM: 601847

KEGG: hsa:8647

STRING: 9606.ENSP00000263817

UniGene: Hs.158316

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*