Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Developmental Biology
Alternative Names
BMP-3; BMP-3A; bmp3; BMP3_HUMAN; BMP3A; Bone morphogenetic protein 3 (osteogenic); Bone morphogenetic protein 3; Bone morphogenetic protein 3A; Osteogenin
Species
Homo sapiens (Human)
Expression Region
363-472aa
Target Protein Sequence
QWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
This Recombinant Human BMP3 protein was made through genetic engineering. By putting the BMP3 gene into the genetic material of E.coli cell, the E.coli could be used as factories or producers to make the desired BMP3 protein for research uses. The expression region of this protein is at 363-472aa. C-terminal Myc tag was used in the expression process. The purity is 85%+ determined by SDS-PAGE.
BMP3, a member of the TGF-β superfamily, plays an important role in embryonic development by inducing and patterning early skeletal formation. It was previously reported that BMP3 could interact with activing type IIB receptor to inhibit activin signaling during embryogenesis in Xenopus embryos. However, BMP3 was also shown to stimulate proliferation of human mesenchymal stem cells, a process that could be blocked by SB431542, an inhibitor of TGF-β/activin receptor kinase, suggesting that BMP3 could exert two-way regulatory effects on activin signaling in distinct cell types. Although it is well known that Activin, ActRII, and Alk4 (a member of TGFβ/Activin type I receptor family) coordinate to transduce signals down the activin signaling pathway, no specific receptor has been identified for BMP3 in mammals, and how interaction of BMP3 and its receptor modulates activities of its downstream effectors is still unclear. Recent studies have found that BMP3 may play a critical role in tumorigenesis in multiple types of tissues. It is found hypermethylated and inactive in gastric carcinoma and cholangiocarcinoma.