Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

BMP3

Uniprot No.

P12645

Research Area

Developmental Biology

Alternative Names

BMP-3; BMP-3A; bmp3; BMP3_HUMAN; BMP3A; Bone morphogenetic protein 3 (osteogenic); Bone morphogenetic protein 3; Bone morphogenetic protein 3A; Osteogenin

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

363-472aa

Target Protein Sequence

QWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

13.9 kDa

Protein Length

Full Length of Mature Protein

Tag Info

C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

This Recombinant Human BMP3 protein was made through genetic engineering. By putting the BMP3 gene into the genetic material of E.coli cell, the E.coli could be used as factories or producers to make the desired BMP3 protein for research uses. The expression region of this protein is at 363-472aa. C-terminal Myc tag was used in the expression process. The purity is 85%+ determined by SDS-PAGE.

BMP3, a member of the TGF-β superfamily, plays an important role in embryonic development by inducing and patterning early skeletal formation. It was previously reported that BMP3 could interact with activing type IIB receptor to inhibit activin signaling during embryogenesis in Xenopus embryos. However, BMP3 was also shown to stimulate proliferation of human mesenchymal stem cells, a process that could be blocked by SB431542, an inhibitor of TGF-β/activin receptor kinase, suggesting that BMP3 could exert two-way regulatory effects on activin signaling in distinct cell types. Although it is well known that Activin, ActRII, and Alk4 (a member of TGFβ/Activin type I receptor family) coordinate to transduce signals down the activin signaling pathway, no specific receptor has been identified for BMP3 in mammals, and how interaction of BMP3 and its receptor modulates activities of its downstream effectors is still unclear. Recent studies have found that BMP3 may play a critical role in tumorigenesis in multiple types of tissues. It is found hypermethylated and inactive in gastric carcinoma and cholangiocarcinoma.

Target Background

Function

Growth factor of the TGF-beta superfamily that plays an essential role in developmental process by inducing and patterning early skeletal formation and by negatively regulating bone density. Antagonizes the ability of certain osteogenic BMPs to induce osteoprogenitor differentitation and ossification. Initiates signaling cascades by associating with type II receptor ACVR2B to activate SMAD2-dependent and SMAD-independent signaling cascades including TAK1 and JNK pathways.

Gene References into Functions

This study demonstrated that there was a significantly higher frequency of BMP3 methylated DNA in plasma in patients with polyps versus healthy controls with a sensitivity and specificity of 40 and 94%, respectively. PMID: 29892846
BMP3 - the biomarker of a currently in-use multi-target stool DNA test was commonly expressed in tumor tissue specimens, independent of Fecal Immunochemical Test result. PMID: 28044229
Methylation level in stool decreases dramatically following colorectal cancer resection PMID: 24993691
Bone morphogenic protein 3 signaling in the regulation of osteogenesis. PMID: 23127436
As an addition to PRKG2 and RASGEFIB genes, we propose to include BMP3 gene as the principal determinant of the observed common phenotype. PMID: 22303795
a critical link between HNF1A-MODY-induced alterations in Bmp-3 expression and insulin gene levels PMID: 21628466
Features supportive of positive selection in the BMP3 gene were found including the presence of an excess of nonsynonymous mutations in modern humans, and a significantly lower genetic diversity that deviates from neutrality PMID: 20532035
Data suggest that promotor region methylation of the BMP3 gene may cause gastric carcinoma in Chinese people. PMID: 20238409
These results demonstrate that BMP-3 stimulates mesenchymal stem cell proliferation via the TGF-beta/activin signaling pathway. PMID: 20143330
The expression signals of BMP3 mRNA in malignant schwannoma were relatively lower than in benign lesions PMID: 11642720
BMP-3 receptor specificity is controlled by the interaction of Lys-30 of BMP-3 with Glu-76 of ActRIIb PMID: 17924656
BMP3 silencing is an early and frequent event in colorectal tumors progressing via the serrated and traditional pathways. PMID: 18311777

Hide All

Subcellular Location

Secreted.

Protein Families

TGF-beta family

Tissue Specificity

Expressed in adult and fetal cartilage.

Database Links

HGNC: 1070

OMIM: 112263

KEGG: hsa:651

STRING: 9606.ENSP00000282701

UniGene: Hs.387411

Code	CSB-EP002739HUf1
Abbreviation	Recombinant Human BMP3 protein
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Bone morphogenetic protein 3 (BMP3)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage