Recombinant Human Bone morphogenetic protein 3(BMP3)

In Stock
Code CSB-EP002739HUf1
Product Type Recombinant Protein
Size US$1726
Uniprot No. P12645
Relevance Negatively regulates bone density. Antagonizes the ability of certain osteogenic BMPs to induce osteoprogenitor differentitation and ossification.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence QWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR
Research Area Developmental Biology
Source E.coli
Gene Names BMP3
Protein Names Bone morphogenetic protein 3A ;BMP-3AOsteogenin
Expression Region 363-472aa
Tag Info C-terminal Myc-tagged
Mol. Weight 13.9 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Negatively regulates bone density. Antagonizes the ability of certain osteogenic BMPs to induce osteoprogenitor differentitation and ossification.
Subcellular Location Secreted
Protein Families TGF-beta family
Tissue Specificity Expressed in adult and fetal cartilage.
Database Links

HGNC: 1070

OMIM: 112263

KEGG: hsa:651

STRING: 9606.ENSP00000282701

UniGene: Hs.387411

Related Products

BMP3 Antibodies

BMP3 Antibodies for Human

BMP3 Antibodies for Homo sapiens (Human)

BMP3 Proteins

BMP3 Proteins for Homo sapiens (Human)

BMP3 ELISA Kit

BMP3 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.