Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Developmental Biology
Alternative Names
BMP-3; BMP-3A; bmp3; BMP3_HUMAN; BMP3A; Bone morphogenetic protein 3 (osteogenic); Bone morphogenetic protein 3; Bone morphogenetic protein 3A; Osteogenin
Species
Homo sapiens (Human)
Expression Region
363-472aa
Target Protein Sequence
QWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The region for expressing recombinant Human BMP3 contains amino acids 363-472. The expected molecular weight for the BMP3 protein is calculated to be 16.4 kDa. This BMP3 recombinant protein is manufactured in e.coli. The N-terminal 6xHis tag was fused into the coding gene segment of BMP3, making it easier to detect and purify the BMP3 recombinant protein in the later stages of expression and purification.
Bone Morphogenetic Protein 3 (BMP3) is a protein that has garnered significant attention in biomedical research. One of its primary areas of study is in the field of osteobiology, where BMP3 plays a crucial regulatory role in bone development and maintenance. Research indicates that BMP3 is involved in physiological and pathological processes such as osteoblast differentiation, bone formation, and osteoporosis. The functional mechanisms of BMP3 in aspects like bone fracture repair and metabolic disorders have sparked widespread interest among scientists. Additionally, BMP3's exploration extends to areas such as muscle biology and joint diseases. In muscle growth and repair, BMP3 also plays a certain role. Abnormal expression of BMP3 is associated with diseases like arthritis, making it a focus of research in understanding its specific role in joint health.
