Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Code | CSB-EP002748HU |
Size | $1812 |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Purity | Greater than 90% as determined by SDS-PAGE. |
Target Names | BMPR1A |
Uniprot No. | P36894 |
Research Area | Cardiovascular |
Alternative Names | 10q23del; Activin A receptor type II like kinase 3; Activin receptor like kinase 3; Activin receptor-like kinase 3; ACVRLK 3; ACVRLK3; ALK 3; ALK-3; ALK3; BMP type-1A receptor; BMPR 1A; Bmpr; BMPR-1A; Bmpr1a; BMR1A_HUMAN; Bone morphogenetic protein receptor type IA; Bone morphogenetic protein receptor type IA precursor; Bone morphogenetic protein receptor type-1A; BR 1a; BR1a; CD 292; CD292; CD292 antigen; EC 2.7.11.30; Serine threonine protein kinase receptor R5; Serine threonine protein kinase receptor R5 precursor; Serine/threonine-protein kinase receptor R5; SKR 5; SKR5; zBMPR IA; zBMPRIA |
Species | Homo sapiens (Human) |
Source | E.coli |
Expression Region | 177-532aa |
Target Protein Sequence | KHYCKSISSRRRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQVGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAHRDLKSKNILIKKNGSCCIADLGLAVKFNSDTNEVDVPLNTRVGTKRYMAPEVLDESLNKNHFQPYIMADIYSFGLIIWEMARRCITGGIVEEYQLPYYNMVPSDPSYEDMREVVCVKRLRPIVSNRWNSDECLRAVLKLMSECWAHNPASRLTALRIKKTLAKMVESQDVKI Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 56.6kDa |
Protein Length | Cytoplasmic Domain |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for BMP2, BMP4, GDF5 and GDF6. Positively regulates chondrocyte differentiation through GDF5 interaction. Mediates induction of adipogenesis by GDF6.
|
Gene References into Functions |
|
Involvement in disease | Juvenile polyposis syndrome (JPS); Polyposis syndrome, mixed hereditary 2 (HMPS2) |
Subcellular Location | Cell membrane; Single-pass type I membrane protein. Cell surface. |
Protein Families | Protein kinase superfamily, TKL Ser/Thr protein kinase family, TGFB receptor subfamily |
Tissue Specificity | Highly expressed in skeletal muscle. |
Database Links |
HGNC: 1076 OMIM: 174900 KEGG: hsa:657 STRING: 9606.ENSP00000224764 UniGene: Hs.524477 |