Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

CLECL1

Uniprot No.

Q8IZS7

Research Area

Immunology

Alternative Names

Dendritic cell-associated lectin 1

Species

Homo sapiens (Human)

Source

Baculovirus

Expression Region

89-167aa

Target Protein Sequence

KTVRTSPLELAFPLQRSVSFNFSTVHKSCPAKDWKVHKGKCYWIAETKKSWNKSQNDCAINNSYLMVIQDITAMVRFNI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

13 kDa

Protein Length

Partial

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The expression region of this recombinant Human CLECL1 covers amino acids 89-167. This CLECL1 protein is expected to have a theoretical molecular weight of 13 kDa. This CLECL1 recombinant protein is manufactured in baculovirus. The CLECL1 gene fragment has been modified by fusing the N-terminal 10xHis tag and C-terminal Myc tag, providing convenience in detecting and purifying the recombinant CLECL1 protein during the following stages.

Target Background

Function

May function in mediating immune cell-cell interactions. May act as a T-cell costimulatory molecule, enhancing anti-CD3-induced proliferation. May play a role in the interaction of dendritic cells with T-cells and the cells of the adaptive immune response.

Gene References into Functions

C-type lectin-like molecule-1 is expressed in 86.5% of cases of acute myeloid leukemia, in 54.5% of acute myeloid leukemia CD34positiveCD38negative stem cells, but not in acute lymphoblastic leukemia blast cells. PMID: 19648166
DCAL-1, highly expressed on dendritic cells and B lymphocytes, acts as a T cell costimulatory molecule which skews CD4+ T cells toward a Th2 response by enhancing their secretion of IL-4. PMID: 12421943
incubation of immature DCs (iDCs) with an anti-DCAL-1 monoclonal antibody (mAb) induced downstream signaling, including phosphorylation of c-Jun N-terminal kinase (JNK) and p44/42 MAP kinase. PMID: 19027044

Subcellular Location

Cell membrane; Single-pass type II membrane protein.

Tissue Specificity

Expressed in spleen, lymph node, and tonsil. Lower expression in peripheral blood, bone marrow, and colon. No expression detected in thymus. Highly expressed in dendritic and B-cells.

Database Links

HGNC: 24462

OMIM: 607467

KEGG: hsa:160365

STRING: 9606.ENSP00000331766

UniGene: Hs.560087

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-BP811639HU
Abbreviation	Recombinant Human CLECL1 protein, partial
MSDS	MSDS Datasheet
Size	$528
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Putative C-type lectin-like domain family 1 (CLECL1P), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage