Recombinant Human C4b-binding protein alpha chain (C4BPA)

Code CSB-YP003951HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP003951HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP003951HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP003951HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP003951HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
C4BPA
Uniprot No.
Research Area
Immunology
Alternative Names
C4b-binding protein alpha chain; C4bp; C4bpa; C4BPA_HUMAN; Complement component 4 binding protein alpha; Complement component 4 binding protein; Proline-rich protein; PrP; RP11-164O23.4
Species
Homo sapiens (Human)
Expression Region
49-597aa
Target Protein Sequence
NCGPPPTLSFAAPMDITLTETRFKTGTTLKYTCLPGYVRSHSTQTLTCNSDGEWVYNTFCIYKRCRHPGELRNGQVEIKTDLSFGSQIEFSCSEGFFLIGSTTSRCEVQDRGVGWSHPLPQCEIVKCKPPPDIRNGRHSGEENFYAYGFSVTYSCDPRFSLLGHASISCTVENETIGVWRPSPPTCEKITCRKPDVSHGEMVSGFGPIYNYKDTIVFKCQKGFVLRGSSVIHCDADSKWNPSPPACEPNSCINLPDIPHASWETYPRPTKEDVYVVGTVLRYRCHPGYKPTTDEPTTVICQKNLRWTPYQGCEALCCPEPKLNNGEITQHRKSRPANHCVYFYGDEISFSCHETSRFSAICQGDGTWSPRTPSCGDICNFPPKIAHGHYKQSSSYSFFKEEIIYECDKGYILVGQAKLSCSYSHWSAPAPQCKALCRKPELVNGRLSVDKDQYVEPENVTIQCDSGYGVVGPQSITCSGNRTWYPEVPKCEWETPEGCEQVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL
Mol. Weight
63.7kDa
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Controls the classical pathway of complement activation. It binds as a cofactor to C3b/C4b inactivator (C3bINA), which then hydrolyzes the complement fragment C4b. It also accelerates the degradation of the C4bC2a complex (C3 convertase) by dissociating the complement fragment C2a. Alpha chain binds C4b. It interacts also with anticoagulant protein S and with serum amyloid P component.
Gene References into Functions
  1. The rs73079108 polymorphism in the 5' upstream region of C4BPA was associated with EH, and rs73079108A may be an independent predictor. PMID: 28627632
  2. INDEED also identified some candidates previously reported to be relevant to HCC, such as intercellular adhesion molecule 2 (ICAM2) and c4b-binding protein alpha chain (C4BPA), which were missed by both Differential expression and differential network analyses PMID: 27592383
  3. Exposure to arterial blood pressure leads to a transient presence of C4bp in the saphenous vein wall. PMID: 28163174
  4. Proteomics study showed a strong association of FN1, A2M, C4BPA and CFB in molecular subtypes of breast cancer, in which, C4BPA and A2M demonstrated a potent signature in blood plasma and tissue samples of Luminal-B (LB) and Triple-negative (TN)subtypes in BC patients, respectively. PMID: 27498393
  5. genetic polymorphism is associated with spontaneous abortion; review PMID: 26658464
  6. whereas the presence of plasminogen did not affect the factor I cofactor activity of C4BP, the activation of plasminogen by urokinase-type plasminogen activator to active plasmin was significantly augmented in the presence of C4BP. PMID: 26067271
  7. C4BPB/C4BPA may not confer susceptibility to schizophrenia among Han Chinese PMID: 25660618
  8. these data suggest that when C4BP is bound to Ail, fI can cleave and inactivate C4b that has bound covalently to bacterial surface structures as well as C4b bound noncovalently to Ail. PMID: 24760758
  9. In patients treated with tacrolimus and mycophenolate mophetil as a maintenance immunosuppression, the lower C4d urinary excretion in early post-transplant period seems to be a low significance prognostic marker of a better long-term kidney outcome. PMID: 24779215
  10. mutations in women experiencing recurrent miscarriages PMID: 23508668
  11. The heptameric core structure is stabilized by intermolecular disulfide bonds. PMID: 23274142
  12. C4BP alpha7beta0 isoform complement control protein-6 domain of C4BP alpha-chain is necessary for tolerogenic activity of the acute-phase C4BPbeta chain. PMID: 23390292
  13. The Lsa30 (LIC110870) is a novel adhesin that binds plasminogen and the complement regulator C4bp. PMID: 22732096
  14. Human pneumococcal glycolytic enzyme enolase, a nonclassical cell surface and plasminogen-binding protein, is a pneumococcal C4BP-binding protein. PMID: 22925928
  15. NC4 Domain of cartilage-specific collagen IX inhibits complement directly due to attenuation of membrane attack formation and indirectly through binding and enhancing activity of complement inhibitors C4B-binding protein and factor H. PMID: 21659506
  16. C4BP is recruited to the S. aureus surface where it functions to inhibit C4 complement effectors, suggesting a previously undescribed immune evasion strategy for this pathogen. PMID: 22333221
  17. Human pentraxin 3 binds to the complement regulator c4b-binding protein. PMID: 21915248
  18. Serum C4BP level in 89 patients showed a strong association with the clinical staging of non small cell lung carcinoma. PMID: 21262398
  19. C4BPB/C4BPA is a new susceptibility locus for venous thrombosis with unknown protein S-independent mechanism: results from genome-wide association and gene expression analyses followed by case-control studies. PMID: 20212171
  20. Binding of the classical pathway inhibitor, C4b-binding protein (C4bp), to three genospecies of B. burgdorferi sensu lato, is demonstrated. PMID: 20022381
  21. Data show that C4BP does not bind CD40, but it forms stable high molecular weight complexes with soluble CD40 ligand (sCD154). PMID: 17225862
  22. structural requirements for the intracellular subunit polymerization PMID: 12135356
  23. Localization of binding sites for a number of C4BP ligands in relation to well-established and novel functions of C4BP. Review PMID: 15179322
  24. To determine the regions of C4b contributing to C4BP binding, the binding of the C4c and C4dg subfragments of C4b to C4BP was examined. PMID: 16819837
  25. Non-small cell lung cancer (NSCLC) cells produce soluble complement inhibitors factor I (FI) and C4b-binding protein (C4BP). PMID: 17548110
  26. The binding sites to Neisseria gonorrhoeae Por1A protein have been mapped within complement control protein domain 1 of C4BP. PMID: 17579075
  27. A novel non-synonymous polymorphism (p.Arg240His) in C4b-binding protein is associated with atypical hemolytic uremic syndrome and leads to impaired alternative pathway cofactor activity. PMID: 18424762
  28. C4BP binds to dead brain cells and Abeta peptide in vitro, is present in CSF and possibly protects against excessive complement activation in AD brains. PMID: 18556068
  29. These results reinforce the case for the occupation of some of the seven arms of C4BP in a multivalent interaction with DNA or surface bound glycosaminoglycans while other arms engage C4b or C3b. PMID: 18715646
  30. Mainly the central core of C4BP mediates binding to small leucine-rich repeat proteins (SLRPs). Binding of SLRPs to C4BP does not not affect its ability to inhibit complement. PMID: 19155499
  31. isoforms of a group B streptococcus-secreted component named Fib displayed differential binding capacities for fibronectin, fibrinogen, and C4BP PMID: 19417080
  32. C4BP binding varies between strains but is dependent on the expression of pneumococcal surface protein C, PspC of group 4 PMID: 19494311
  33. The primary binding site on C4bp is located on the alpha-chain complement control protein 4 (CCP4) domain which, unlike C4bp alpha-chain amino-terminal CCP1 and CCP2, is not involved in complement regulatory activity. PMID: 11441101

Show More

Hide All

Subcellular Location
Secreted.
Tissue Specificity
Chylomicrons in the plasma.
Database Links

HGNC: 1325

OMIM: 120830

KEGG: hsa:722

STRING: 9606.ENSP00000356037

UniGene: Hs.1012

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1