Recombinant Human CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase (ST3GAL3), partial

In Stock
Code CSB-EP606136HU
Abbreviation Recombinant Human ST3GAL3 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
ST3GAL3
Uniprot No.
Research Area
Signal Transduction
Alternative Names
3 sialyltransferase; 3(4) GlcNAc alpha-2; 3-sialyltransferase 3; 3-sialyltransferase; 3-ST 3; 4-galactoside alpha-2; 4GlcNAc alpha 2 3 sialyltransferase; Alpha 2 3 sialyltransferase II; Alpha 2 3 sialyltransferase III; Alpha 2 3 ST 3; Alpha 2; Beta galactoside alpha 3 sialyltransferase 3; Beta-galactoside alpha-2; CMP N acetylneuraminate beta 1 4 galactoside alpha 2 3 sialyltransferase; CMP-N-acetylneuraminate-beta-1; EC 2.4.99.6; Gal beta 1 3; Gal beta 1 3(4) GlcNAc alpha 2 3 sialyltransferase; Gal beta 1 3(4)GlcNAc alpha 2 3 sialyltransferase; Gal beta-1; N acetyllactosaminide alpha 2 3 sialyltransferase; N-acetyllactosaminide alpha-2; OTTHUMP00000008820; OTTHUMP00000008821; OTTHUMP00000008822; OTTHUMP00000008823; Sialyltransferase 6 (N acetyllacosaminide alpha 2 3 sialyltransferase); Sialyltransferase 6; SIAT6; SIAT6_HUMAN; ST3 beta galactoside alpha 2 3 sialyltransferase 3; ST3 beta galactoside alpha 2,3 sialyltransferase 3; ST3Gal III; St3gal3; ST3GALII; ST3GalIII; ST3N
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
29-375aa
Target Protein Sequence
KLHLLQWEEDSNSVVLSFDSAGQTLGSEYDRLGFLLNLDSKLPAELATKYANFSEGACKPGYASALMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLRCRRCIIVGNGGVLANKSLGSRIDDYDIVVRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
54.9kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the formation of the NeuAc-alpha-2,3-Gal-beta-1,4-GlcNAc-, NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc- and NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc- sequences found in terminal carbohydrate groups of glycoproteins and glycolipids. The highest activity is toward Gal-beta-1,3-GlcNAc and the lowest toward Gal-beta-1,3-GalNAc.
Gene References into Functions
  1. CA19.9 appears as a physiological product whose synthesis strongly depends on the tissue specific and epigenetically-regulated expression of B3GALT5 and ST3GAL3. PMID: 27535614
  2. ST3Gal3 knockdown synergistically enhanced cisplatin-induced apoptosis in ovarian cancer cells PMID: 27871859
  3. ST3Gal III modulates breast cancer cell adhesion and invasion by altering the expression of invasion-related molecules. PMID: 27779707
  4. Dysfunctional ST3GAL3 may result in perturbation of the posttranslational sialylation of proteins in these pathways PMID: 23252400
  5. ST3GAL3 mutations impair the development of higher cognitive functions. PMID: 21907012
  6. Characterization of the promoter region of the ST3Gal III gene. PMID: 12697334
  7. 19 different transcripts of ST3GalIII were isolated and cloned; tissue distribution analysis showed complex patterns in neural and muscular tissues PMID: 12815231
  8. High levels of ST3GAL-III in the tumor tissue correlated with secondary local tumor recurrence (p = 0.005; p = 0.012). PMID: 12931020
  9. Identification of a new ST3Gal3 transcript from fetal brain. PMID: 15316282

Show More

Hide All

Involvement in disease
Mental retardation, autosomal recessive 12 (MRT12); Epileptic encephalopathy, early infantile, 15 (EIEE15)
Subcellular Location
Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein. Secreted. Note=Membrane-bound form in trans cisternae of Golgi. Secreted into the body fluid.
Protein Families
Glycosyltransferase 29 family
Tissue Specificity
Highly expressed in adult skeletal muscle and in all fetal tissues examined and to a much lesser extent in placenta, lung and liver.
Database Links

HGNC: 10866

OMIM: 606494

KEGG: hsa:6487

UniGene: Hs.597915

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*