Recombinant Human Cancer/testis antigen 2(CTAG2)

Code CSB-YP006127HUa4
Product Type Recombinant Protein
Size US$2959
Uniprot No. O75638
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence MQAEGQGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPRGGAPRGPHGGAASAQDGRCPCGARRPDSRLLQLHITMPFSSPMEAELVRRILSRDAAPLPRPGAVLKDFTVSGNLLFMSVRDQDREGAGRMRVVGWGLGSASPEGQKARDLRTPKHKVSEQRPGTPGPPPPEGAQGDGCRGVAFNVMFSAPHI
Research Area Others
Source Yeast
Gene Names CTAG2
Protein Names Autoimmunogenic cancer/testis antigen NY-ESO-2 Cancer/testis antigen 6.2 Short name: CT6.2 L antigen family member 1 Short name: LAGE-1 ESO2, LAGE1
Expression Region 1-210aa
Tag Info N-terminal 6xHis-sumostar-tagged
Mol. Weight 37.1 kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat

Related Products

CTAG2 Antibodies

CTAG2 Antibodies for Homo sapiens (Human)

CTAG2 Proteins

CTAG2 Proteins for Homo sapiens (Human)

CTAG2 ELISA Kit

CTAG2 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.