Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
Autoimmunogenic cancer/testis antigen NY ESO 2; Autoimmunogenic cancer/testis antigen NY-ESO-2; CAMEL; Cancer/testis antigen 2; Cancer/testis antigen 6.2; CT 2; CT2; CT6.2; CTAG 2; CTAG2; CTAG2_HUMAN; CTL recognized antigen on melanoma; ESO 2; ESO2; L antigen family member 1; LAGE 1; LAGE 1a protein; LAGE 2b; LAGE-1; LAGE1; LAGE2b; MGC138724; MGC3803
Species
Homo sapiens (Human)
Expression Region
1-210aa
Target Protein Sequence
MQAEGQGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPRGGAPRGPHGGAASAQDGRCPCGARRPDSRLLQLHITMPFSSPMEAELVRRILSRDAAPLPRPGAVLKDFTVSGNLLFMSVRDQDREGAGRMRVVGWGLGSASPEGQKARDLRTPKHKVSEQRPGTPGPPPPEGAQGDGCRGVAFNVMFSAPHI
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
To make this Recombinant Human CTAG2 protein, the CTAG2 gene was isolated at first and cloned into an expression vector. CUSABIO has built a mature recombinant protein platform. This Recombinant Human CTAG2 protein was developed in the platform. It was expressed in E.coli at the region of 1-210aa of the Human CTAG2 protein. N-terminal 6xHis-SUMO tag was fused with the expression vector for affinity and purification purposes. The purity is 90%+ determined by SDS-PAGE.
Cancer testis antigen 2 gene (CTAG2) has been identified as a potential hepatocellular carcinoma therapeutic target by hub gene screening with topological analysis. The HCC patient samples from TCGA were divided into the high and low CTAG2 expression groups based on their median value. Survival was analysed by constructing Kaplan-Meier curves (log-rank test), while Cox regression analysis was used to performed univariable and multivariable analysis. In total, 6 hub genes appeared in at least three topological analysis methods, including CTAG2. CTAG2 was regarded as the most important hub gene. According to the RNA-seq expression data of tumor tissue included in TCGA LIHC, the expression of CTAG2 was not associated with the patient gender, but was significantly associated with the patient age.
