Recombinant Human Carbonic anhydrase 1(CA1)

Code CSB-EP004364HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P00915
Relevance Reversible hydration of carbon dioxide. Can hydrates cyanamide to urea.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Carbonate dehydratase I;Carbonic anhydrase B ;CAB;Carbonic anhydrase I ;CA-I
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
Research Area Cardiovascular
Source E.coli
Gene Names CA1
Expression Region 2-261aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 44.7kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
References
Still Have Questions? Leave a Message or Start an on-line Chat
Function Reversible hydration of carbon dioxide. Can hydrates cyanamide to urea.
Subcellular Location Cytoplasm
Protein Families Alpha-carbonic anhydrase family
Database Links

HGNC: 1368

OMIM: 114800

KEGG: hsa:759

STRING: 9606.ENSP00000256119

UniGene: Hs.23118

Related Products

CA1 Antibodies

CA1 Antibodies for Homo sapiens (Human)

CA1 Antibodies for Human

CA1 Proteins

CA1 Proteins for Homo sapiens (Human)

CA1 ELISA Kit

CA1 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.