Recombinant Human Carbonic anhydrase 1(CA1)

Code CSB-EP004364HU
Size US$1726
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names CA1
Uniprot No. P00915
Research Area Cardiovascular
Alternative Names CA 1; CA I; CA-I; CA1; CAB; CAH1_HUMAN; CAI; CAN; Car 1; Car1; Carbonate dehydratase I; Carbonic anhydrase 1; Carbonic anhydrase A; Carbonic anhydrase B; Carbonic anhydrase B; formerly; Carbonic anhydrase I; Carbonic dehydratase; ECK0125; JW0122; yadF
Species Homo sapiens (Human)
Source E.coli
Expression Region 2-261aa
Target Protein Sequence ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 44.7kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal 6xHis-SUMO-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Citations

Rapid detection of 6×-histidine-labeled recombinant proteins by immunochromatography using dye-labeled cellulose nanobeads. Choi ES.et al,Biotechnol Lett.,2015

Reivew: To analyze the ability of this IC assay method to identify other His-tagged proteins, recombinant carbonic anhydrase I and
fructose bisphosphate aldolase were prepared from 0.12 to 30 lg/ml.
PMID: 25388454

Target Data

Function Reversible hydration of carbon dioxide. Can hydrates cyanamide to urea.
Gene References into Functions
  1. Anti-CA I and II antibody levels were investigated using ELISA in serum samples from 30 patients with Acute Myeloid Leukemia (AML) and 30 healthy peers. Anti-CA I and II antibody titers in the AML group were significantly higher compared with the control group (p=0.0001 and 0.018, respectively). PMID: 28270370
  2. These six-membered carbocycles showed nice inhibitory action against AChE and human carbonic anhydrase (hCA) II and I isoforms. The hCA I, II, and AChE were efficiently inhibited by these molecules, with Ki values in the range of 6.70-35.85 nM for hCA I, 18.77-60.84 nM for hCA II, and 0.74-4.60 for AChE, respectively PMID: 28613396
  3. These results showed that flavonoids especially malvin and oenin effectively inhibited hCA I and II isoenzymes. PMID: 28445001
  4. Discovery of potent carbonic anhydrase, acetylcholinesterase, and butyrylcholinesterase enzymes inhibitors: The new amides and thiazolidine-4-ones synthesized on an acetophenone base. PMID: 28544359
  5. Here are presented solved the first crystal structures of carbonic anhydrase 1and carbonic anhydrase 2 in complex with polmacoxib, at 2.0 A and 1.8 A, respectively. PMID: 27475498
  6. Neuronal carbonic anhydrase I (CA1) appears to be associated with the endoplasmic reticulum subcellular structure. PMID: 27809276
  7. CA1 is highly expressed in the sera of stage I non-small cell lung cancer patients PMID: 26232327
  8. We demonstrated that resveratrol, caffeic acid, and tannic acid in stored blood could decrease the sensitivity to oxidation of erythrocytes in vitro but did not exhibit such effects on Carbonic Anhydrase activity. PMID: 27413740
  9. CA1 is a potential oncogene and that it contributes to abnormal cell calcification, apoptosis and migration in breast cancer. PMID: 26459317
  10. We report on the competitive zinc metalation of apo-carbonic anhydrase [CA; metal-free CA (apo-CA)] in the presence of apo-metallothionein 1A domain fragments to identify domain specific determinants of zinc binding and zinc donation PMID: 26475450
  11. The gene encoding CA1 is susceptible to ankylosing spondylitis and plays a role in the process of bone formation. PMID: 22838845
  12. Structure-activity relationships study showed that indolylchalcone derivatives have higher inhibitory activities than pyrido[2,3-d]pyrimidine derivatives on hCA I and hCA II. PMID: 25165709
  13. Myocardial carbonic anhydrase 1/2 activation is significantly elevated in diabetic ischemic cardiomyopathy. PMID: 24670789
  14. may be involved in the pathogenesis of Abdominal aortic aneurysm PMID: 23557951
  15. The new prognostic biomarkers GRP78, Fructose-bisphosphate Aldolase A (ALDOA), Carbonic Anhydrase I (CA1) and Peptidyl-prolyl cis-trans isomerase A or Cyclophilin A (PPIA)) provided good survival prediction for TNM stage I-IV patients. PMID: 22996014
  16. A significant correlation was found between positive carbonic anhydrase I staining and oral squamous cell carcinoma for more advanced clinical stage and larger tumor size, but not for positive lymph node metastasis, distal metastasis, and recurrence. PMID: 22416960
  17. carbonic anhydrase I, phosphoglycerate kinase 1 and apolipoprotein A-I appeared to be the most significant variations of proteins in patients with osteopenia and osteoarthritis PMID: 22619369
  18. A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration. PMID: 22360420
  19. Overexpression of CA1 in the synovial tissues of ankylosing spondylitis (AS) patients may promote improper calcification and bone resorption in AS. PMID: 21143847
  20. single mutation of an amino acid not considered essential to catalysis (Phe91Asn) in carbonic anhydrase I, but is near substrate binding pocket, led to increase of catalytic activity; mutant CA I also showed higher affinity for sulfonamide inhibitors PMID: 20624682
  21. The X-ray crystallographic structure of the CA I Michigan 1 variant isozyme is reported, both in the presence and absence of a second bound zinc ion coordinated to His 64, His 200, and Arg 67. PMID: 12009884
  22. concentrations in nondialyzed chronic kidney disease patients, and the relationship with acidosis, zinc, anemia, and iron supplementation PMID: 14675565
  23. cytosolic CA I, II, and XIII are downregulated in neoplastic colorectal mucosa compared to normal colorectal mucosa PMID: 15836783
  24. Isothiocyanato sulfonamide thioureas inhibit this enzyme. PMID: 15837325
  25. X-ray crystallographic structure for the adduct of an activator with hCA I. Binding site interactions of activator L-Histidine with active site amino acids PMID: 16870440
  26. study presents the X-ray structure of the foscarnet adduct with CA1 together with the factors governing recognition of such small molecules by a metalloenzyme active site PMID: 17314045
  27. Decreased levels of carbonic anhydrase 1 isozyme is associated with type II diabetes. PMID: 17464559

Show More

Hide All

Subcellular Location Cytoplasm
Protein Families Alpha-carbonic anhydrase family
Database Links

HGNC: 1368

OMIM: 114800

KEGG: hsa:759

STRING: 9606.ENSP00000256119

UniGene: Hs.23118

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1