Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 3(CEACAM3),Partial

In Stock
Code CSB-EP005163HU
Product Type Recombinant Protein
Size US$1726Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P40198
Lead Time 3-7 business days
Relevance Major granulocyte receptor mediating recognition and efficient opsonin-independent phagocytosis of CEACAM-binding microorganisms, including Neissiria, Moxarella and Haemophilus species, thus playing an important role in the clearance of pathogens by the innate immune system. Responsible for RAC1 stimulation in the course of pathogen phagocytosis.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Carcinoembryonic antigen CGM1 CD_antigen: CD66d
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAG
Research Area Immunology
Source E.coli
Gene Names CEACAM3
Expression Region 35-155aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 29.1kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Major granulocyte receptor mediating recognition and efficient opsonin-independent phagocytosis of CEACAM-binding microorganisms, including Neissiria, Moxarella and Haemophilus species, thus playing an important role in the clearance of pathogens by the innate immune system. Responsible for RAC1 stimulation in the course of pathogen phagocytosis.
Subcellular Location Membrane, Single-pass type I membrane protein
Protein Families Immunoglobulin superfamily, CEA family
Tissue Specificity CGM1a, the predominant CGM1 transcript, is granulocyte-specific. Not detected out of the granulocytic lineage, such as monocytes, lymphocytes, spleen, testis, colon, brain, liver, pancreas, thymus, ovary, placenta, skeletal muscle, prostate, small intesti
Database Links

HGNC: 1815

OMIM: 609142

KEGG: hsa:1084

STRING: 9606.ENSP00000349971

UniGene: Hs.11

Related Products

CEACAM3 Antibodies

CEACAM3 Antibodies for Human

CEACAM3 Antibodies for Homo sapiens (Human)

CEACAM3 Proteins

CEACAM3 Proteins for Homo sapiens (Human)

CEACAM3 ELISA Kit

CEACAM3 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.