Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 4(CEACAM4),partial

Code CSB-EP005164HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. O75871
Relevance Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Carcinoembryonic antigen CGM7Non-specific cross-reacting antigen W236
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSYTLRTINASYDSDQATGQLHVHQNNVPGLPVGAVAG
Research Area Immunology
Source E.coli
Gene Names CEACAM4
Expression Region 36-155aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 16.7kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles.
Subcellular Location Membrane, Single-pass type I membrane protein
Protein Families Immunoglobulin superfamily, CEA family
Tissue Specificity Granulocytes.
Database Links

HGNC: 1816

KEGG: hsa:1089

STRING: 9606.ENSP00000221954

UniGene: Hs.12

Related Products

CEACAM4 Antibodies

CEACAM4 Antibodies for Human

CEACAM4 Proteins

CEACAM4 Proteins for Homo sapiens (Human)

CEACAM4 ELISA Kit

CEACAM4 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.