Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

CEACAM4

Uniprot No.

O75871

Research Area

Immunology

Alternative Names

CEACAM4; CGM7Carcinoembryonic antigen-related cell adhesion molecule 4; Carcinoembryonic antigen CGM7; Non-specific cross-reacting antigen W236

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

36-155aa

Target Protein Sequence

FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSYTLRTINASYDSDQATGQLHVHQNNVPGLPVGAVAG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

16.7kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Amino acids 36-155 form the expressed segment for recombinant Human CEACAM4. This CEACAM4 protein is expected to have a theoretical molecular weight of 16.7 kDa. The CEACAM4 protein was expressed in e.coli. The N-terminal 6xHis tag was fused into the coding gene segment of CEACAM4, making it easier to detect and purify the CEACAM4 recombinant protein in the later stages of expression and purification.

Carcinoembryonic antigen-related cell adhesion molecule 4 (CEACAM4) is mainly studied in the field of male reproductive health. CEACAM4 is a cell adhesion molecule found on the surface of sperm cells, and studies emphasize its significance in mediating interactions between sperm and other cells within the male reproductive system. Researchers are delving into the molecular mechanisms by which CEACAM4 contributes to sperm-egg binding and fertilization, aiming to unravel insights that could have implications for fertility treatments and male reproductive health. While the primary focus is on male reproductive biology, CEACAM4 might also have relevance in broader areas such as cell adhesion research and molecular biology.

Target Background

Function

Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles.

Gene References into Functions

CEACAM4 is expressed in tumor-derived cell lines, and this expression is specific to an medullary thyroid carcinoma derived cell line. PMID: 25152032
CEACAM4 has phagocytic function. PMID: 25567962

Subcellular Location

Membrane; Single-pass type I membrane protein.

Protein Families

Immunoglobulin superfamily, CEA family

Tissue Specificity

Granulocytes.

Database Links

HGNC: 1816

KEGG: hsa:1089

STRING: 9606.ENSP00000221954

UniGene: Hs.12

Code	CSB-EP005164HU
Abbreviation	Recombinant Human CEACAM4 protein, partial
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Cell adhesion molecule CEACAM4 (CEACAM4), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage