Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 7 (CEACAM7)

In Stock
Code CSB-EP005167HU
Abbreviation Recombinant Human CEACAM7 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Tags & Cell Markers
Alternative Names
Carcinoembryonic antigen CGM 2; Carcinoembryonic antigen CGM2; Carcinoembryonic antigen gene family member 2; Carcinoembryonic antigen related cell adhesion molecule 7; Carcinoembryonic antigen-related cell adhesion molecule 7; CEA; CEACAM 7; CEACAM7; CEAM7_HUMAN; CGM 2; CGM2
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
36-242aa
Target Protein Sequence
TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGIYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGPYECEIQNPVGASRSDPVTLNVRYESVQAS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
39.4kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Our Recombinant Human CEACAM7 protein is a high-quality and reliable tool for research involving tags and cell markers. This protein, representing the Carcinoembryonic antigen-related cell adhesion molecule 7 (CEACAM7), is crucial for cellular adhesion, migration, and signal transduction. The product is expressed in E. coli, encompassing the full length of the mature CEACAM7 protein (36-242aa), and is tagged with an N-terminal 6xHis-SUMO for ease of purification and detection.

With a purity greater than 90% as determined by SDS-PAGE, our Recombinant Human CEACAM7 protein is provided as a lyophilized powder, ensuring consistent and dependable performance for your tags and cell markers research. This product allows you to achieve precise and reliable results in various research areas, including cancer biology, inflammation, and immune response.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions
  1. CEACAM7 expression is significantly upregulated in human masticatory mucosa during wound healing PMID: 28005267
  2. crystal structure of the N-terminal dimerization domain of CEACAM has been determined at 1.47 A resolution PMID: 26323304
  3. High CEACAM7 is associated with gastric carcinoma. PMID: 22195770
  4. CEACAM-7 expression is significantly decreased in rectal cancer; a potential tumor marker PMID: 20004437
  5. CGM2 RT-PCR assay provides no specific prognostic information and cannot be used as a decision criterion for adjuvant therapy after colorectal cancer surgery. PMID: 16627067

Show More

Hide All

Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor. Apical cell membrane.
Protein Families
Immunoglobulin superfamily, CEA family
Tissue Specificity
Expressed in columnar epithelial cells of the colon (at protein level). Strongly down-regulated in colonic adenocarcinomas.
Database Links

HGNC: 1819

KEGG: hsa:1087

STRING: 9606.ENSP00000006724

UniGene: Hs.74466

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*