Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Tags & Cell Markers
Alternative Names
Carcinoembryonic antigen CGM 2; Carcinoembryonic antigen CGM2; Carcinoembryonic antigen gene family member 2; Carcinoembryonic antigen related cell adhesion molecule 7; Carcinoembryonic antigen-related cell adhesion molecule 7; CEA; CEACAM 7; CEACAM7; CEAM7_HUMAN; CGM 2; CGM2
Species
Homo sapiens (Human)
Expression Region
36-242aa
Target Protein Sequence
TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGIYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGPYECEIQNPVGASRSDPVTLNVRYESVQAS
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Our Recombinant Human CEACAM7 protein is a high-quality and reliable tool for research involving tags and cell markers. This protein, representing the Carcinoembryonic antigen-related cell adhesion molecule 7 (CEACAM7), is crucial for cellular adhesion, migration, and signal transduction. The product is expressed in E. coli, encompassing the full length of the mature CEACAM7 protein (36-242aa), and is tagged with an N-terminal 6xHis-SUMO for ease of purification and detection.
With a purity greater than 90% as determined by SDS-PAGE, our Recombinant Human CEACAM7 protein is provided as a lyophilized powder, ensuring consistent and dependable performance for your tags and cell markers research. This product allows you to achieve precise and reliable results in various research areas, including cancer biology, inflammation, and immune response.
