Home
Protein
Recombinant Proteins
Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 7 (CEACAM7)

Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 7 (CEACAM7)

^{In Stock}

Code	CSB-EP005167HU
Abbreviation	Recombinant Human CEACAM7 protein
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

CEACAM7

Uniprot No.

Q14002

Research Area

Tags & Cell Markers

Alternative Names

Carcinoembryonic antigen CGM 2; Carcinoembryonic antigen CGM2; Carcinoembryonic antigen gene family member 2; Carcinoembryonic antigen related cell adhesion molecule 7; Carcinoembryonic antigen-related cell adhesion molecule 7; CEA; CEACAM 7; CEACAM7; CEAM7_HUMAN; CGM 2; CGM2

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

36-242aa

Target Protein Sequence

TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGIYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGPYECEIQNPVGASRSDPVTLNVRYESVQAS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

39.4kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Our Recombinant Human CEACAM7 protein is a high-quality and reliable tool for research involving tags and cell markers. This protein, representing the Carcinoembryonic antigen-related cell adhesion molecule 7 (CEACAM7), is crucial for cellular adhesion, migration, and signal transduction. The product is expressed in E. coli, encompassing the full length of the mature CEACAM7 protein (36-242aa), and is tagged with an N-terminal 6xHis-SUMO for ease of purification and detection.

With a purity greater than 90% as determined by SDS-PAGE, our Recombinant Human CEACAM7 protein is provided as a lyophilized powder, ensuring consistent and dependable performance for your tags and cell markers research. This product allows you to achieve precise and reliable results in various research areas, including cancer biology, inflammation, and immune response.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions

CEACAM7 expression is significantly upregulated in human masticatory mucosa during wound healing PMID: 28005267
crystal structure of the N-terminal dimerization domain of CEACAM has been determined at 1.47 A resolution PMID: 26323304
High CEACAM7 is associated with gastric carcinoma. PMID: 22195770
CEACAM-7 expression is significantly decreased in rectal cancer; a potential tumor marker PMID: 20004437
CGM2 RT-PCR assay provides no specific prognostic information and cannot be used as a decision criterion for adjuvant therapy after colorectal cancer surgery. PMID: 16627067

Hide All

Subcellular Location

Cell membrane; Lipid-anchor, GPI-anchor. Apical cell membrane.

Protein Families

Immunoglobulin superfamily, CEA family

Tissue Specificity

Expressed in columnar epithelial cells of the colon (at protein level). Strongly down-regulated in colonic adenocarcinomas.

Database Links

HGNC: 1819

KEGG: hsa:1087

STRING: 9606.ENSP00000006724

UniGene: Hs.74466