Recombinant Human Cell adhesion molecule 3 (CADM3), partial

Code CSB-YP004427HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP004427HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP004427HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP004427HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP004427HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
CADM3
Uniprot No.
Alternative Names
BIgR; Brain immunoglobulin receptor; CADM 3; cadm3; CADM3_HUMAN; Cell adhesion molecule 3; Dendritic cell nectin like protein 1 short isoform; FLJ10698; IgSF4B; Immunoglobulin superfamily member 4B; Necl 1; Necl-1; NECL1; Nectin like 1; Nectin like protein 1; Nectin-like protein 1; Synaptic cell adhesion molecule 3; synCAM3; TSLC1 like 1; TSLC1 like protein 1; TSLC1-like protein 1; TSLL1
Species
Homo sapiens (Human)
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

I would like to know some informations for the product. I also have few questions: - is the product suitable for use in ELISA?

A:
Thanks for your inquiry.
RecombinantHuman Cell adhesion molecule 3(CADM3),partial
CSB-MP004427HU >> Mammalian cell
Express region:25-330aa;Partial, the compelet extracellular domain.
Tag information:N terminal 10xHis-tagged + C terminal Myc-tagged
Sequence:

NLSQDDSQPWTSDETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTLYFGEKRALRDNRIQLVTSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTSQRIEVLYTPTAMIRPDPPHPREGQKLLLHCEGRGNPVPQQYLWEKEGSVPPLKMTQESALIFPFLNKSDSGTYGCTATSNMGSYKAYYTLNVNDPSPVPSSSSTYH


This protein is suitable for Elisa, we have this ELISA kit in our product line:
http://www.cusabio.com/ELISA-Kit/Human-Cell-adhesion-molecule-3CADM3-ELISA-kit-68666.html

Target Background

Function
Involved in the cell-cell adhesion. Has both calcium-independent homophilic cell-cell adhesion activity and calcium-independent heterophilic cell-cell adhesion activity with IGSF4, NECTIN1 and NECTIN3. Interaction with EPB41L1 may regulate structure or function of cell-cell junctions.
Gene References into Functions
  1. CADM3 expression was increased in retinoblastoma tissues and cells. miR-140-5p inhibited CADM3 expression possibly by targeting the 3'-UTR. PMID: 29808799
  2. Nectin-based cell-cell adhesion was formed at the apical side of the junctional adhesion molecule (JAM)-based cell-cell adhesion; cadherin and claudin were recruited to the nectin-3 and JAM-based cell-cell adhesion sites to form AJ- and TJ-like domains. PMID: 24112238
  3. NECL1 can inhibit the migration and invasion of glioma cells and induce differentiation. PMID: 20078932
  4. Findings clearly reveal the structural basis for the cis-dimerization of nectins through the first Ig-like domains. PMID: 21325282
  5. A link might exist between NECL1 and the extracellular matrix protein OPN in inhibiting the migration and invasion of U251 glioma ce PMID: 20598232
  6. NECL1 may inhibit the proliferation of T98G cells by inducing its apoptosis. PMID: 18686605
  7. Nec- 1 suppress the growth and tumorigenic ability of colon cancer cells. PMID: 19565570
  8. Necl-1 is a neural-tissue-specific Ca2+-independent immunoglobulin-like cell-cell adhesion molecule which potentially has membrane-associated guanylate kinase subfamily member-binding activity and localizes at the non-junctional cell-cell contact sites PMID: 15741237
  9. crystallographic analysis of human Nectin-like molecule-1/Syncam3/Tsll1/Igsf4b, a neural tissue-specific immunoglobulin-like cell-cell adhesion molecule PMID: 16467305
  10. human NECL1 is an N-linked glycoprotein with a single glycosylation site at position N290KS PMID: 18420026
  11. Expression of entry receptors nectin-1 and HVEM prevent entry of HSV-1 into human conjunctival epithelium. PMID: 18502984
  12. suggests that NECL1 may act as a tumor suppressor in glioma and loss of it in glioma may be caused by histone deacetylation PMID: 19062177

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cell junction.
Protein Families
Nectin family
Tissue Specificity
Isoform 1 is expressed mainly in adult and fetal brain. Isoform 2 is highly expressed in adult brain and weakly expressed in placenta. In brain, Isoform 2 is highly expressed in cerebellum.
Database Links

HGNC: 17601

OMIM: 609743

KEGG: hsa:57863

UniGene: Hs.365689

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1