Recombinant Human Cell death activator CIDE-3 (CIDEC)

Code CSB-EP842636HU
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
CIDEC
Uniprot No.
Research Area
Cell Biology
Alternative Names
Cell death activator; Cell death activator CIDE-3; Cell death inducing DFFA like effector C; Cell death inducing DFFA like effector protein C; Cell death-inducing DFFA-like effector protein C; CIDE 3; CIDE C; CIDE3; CIDEC; CIDEC_HUMAN; Fat specific protein 27; Fat-specific protein FSP27 homolog; FLJ20871; FPLD5; FSP27
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-238aa
Target Protein Sequence
MEYAMKSLSLLYPKSLSRHVSVRTSVVTQQLLSEPSPKAPRARPCRVSTADRSVRKGIMAYSLEDLLLKVRDTLMLADKPFFLVLEEDGTTVETEEYFQALAGDTVFMVLQKGQKWQPPSEQGTRHPLSLSHKPAKKIDVARVTFDLYKLNPQDFIGCLNVKATFYDTYSLSYDLHCCGAKRIMKEAFRWALFSMQATGHVLLGTSCYLQQLLDATEEGQPPKGKASSLIPTCLKILQ
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
53.8kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Binds to lipid droplets and regulates their enlargement, thereby restricting lipolysis and favoring storage. At focal contact sites between lipid droplets, promotes directional net neutral lipid transfer from the smaller to larger lipid droplets. The transfer direction may be driven by the internal pressure difference between the contacting lipid droplet pair. Its role in neutral lipid transfer and lipid droplet enlargement is activated by the interaction with PLIN1. May act as a CEBPB coactivator in the white adipose tissue to control the expression of a subset of CEBPB downstream target genes, including SOCS1, SOCS3, TGFB1, TGFBR1, ID2 and XDH. When overexpressed in preadipocytes, induces apoptosis or increases cell susceptibility to apoptosis induced by serum deprivation or TGFB treatment. As mature adipocytes, that express high CIDEC levels, are quite resistant to apoptotic stimuli, the physiological significance of its role in apoptosis is unclear. May play a role in the modulation of the response to osmotic stress by preventing NFAT5 to translocate into the nucleus and activate its target genes expression.
Gene References into Functions
  1. FTO increased the lipid accumulation in hepatocytes by increasing nuclear translocation of SREBP1c and SREBP1c maturation, thus improving the transcriptional activity of lipid droplet-associated protein CIDEC. PMID: 29486327
  2. this study has indicated that 3' UTR variation in CIDEC is associated with the risk of elevated fasting glucose, the progression of hypertriglyceridemia and hypertension, and the efficacy of angiotensin II-targeted antihypertensive agents. PMID: 28415694
  3. Two tissue-specific CIDEc isoforms had different roles in lipid deposition. PMID: 29080839
  4. data suggested that Cidec could interact with and down-regulate AMPKalpha through an ubiquitin-proteasome degradation pathway, which provided a possible mechanism of Cidec in promoting human adipocytes differentiation PMID: 26367078
  5. Hepatic expression of FSP27/CIDEC is highly up-regulated in in patients with alcoholic steatohepatitis and this up-regulation contributes to alcohol-induced liver damage. PMID: 26099526
  6. It is insinuated that VAT is associated with late phase obesity CIDEC decrease and insulin resistance, while pioglitazone enhances CIDEC through activation of PPAR-gamma, increases its expression, and decreases lipolysis. PMID: 25210844
  7. After bariatric surgery-induced weight loss, CIDEC/FSP27 gene/protein expression in SAT increased significantly. Findings suggest a positive functional interaction between CIDEC/FSP27 & mitochondrial biogenesis-related genes in human adipose tissue PMID: 24126816
  8. results demonstrate a crucial role for FSP27-ATGL interactions in regulating lipolysis, triglyceride accumulation, and insulin signaling in human adipocytes PMID: 24627478
  9. homo-dimeric structure of the CIDE-N domain of FSP27 will provide important information that will enable better understanding of the function of FSP27. PMID: 24025675
  10. CIDE proteins expression correlate with tumor and survival characteristics in patients with renal cell carcinoma. PMID: 23475172
  11. Fsp27/CIDEC is a CREB target gene induced during early fasting in liver and regulated by FA oxidation rate. PMID: 23220584
  12. The results suggest that FSP27 not only modulates LD homeostasis but also modulates the response to osmotic stress via a physical interaction with NFAT5 at the LD surface. PMID: 23233732
  13. The expression of CIDE-3 was decreased in hepatocellular carcinoma (HCC) tissue, compared to adjacent normal tissues, and CIDE-3 expression and HCC differentiation were positively correlated. PMID: 20957525
  14. Results demonstrated that CIDEC-induced apoptosis was independent of FADD, suggesting that CIDEC-induced apoptosis might be in a death-receptor-independent, caspase-8-dependent manner. PMID: 21865223
  15. Insulin regulates CIDEA and CIDEC expression via PI3K, and it regulates expression of each protein via Akt1/2-and JNK2-dependent pathways, respectively, in human adipocytes. PMID: 21636835
  16. These results suggest that CIDEA and CIDEC are novel genes regulated by insulin in human adipocytes and may play key roles in the effects of insulin, such as anti-apoptosis and lipid droplet formation. PMID: 20154362
  17. Fat-specific protein 27 undergoes ubiquitin-dependent degradation regulated by triacylglycerol synthesis and lipid droplet formation PMID: 20089860
  18. Following gastric bypass the hepatic expression of CIDEC is downregulated by marked weight loss. PMID: 19661960
  19. CIDEC is required for unilocular lipid droplet formation and optimal energy storage in human. PMID: 20049731
  20. cloning and characterization as a member of the cell-death-inducing DNA-fragmentation-factor (DFF45)-like effector family PMID: 12429024
  21. FSP27 binds to lipid droplets and regulates their enlargement PMID: 18334488
  22. CIDEC is a regulator of adipocyte lipid metabolism and may be important for the adipocyte to adapt to changes in energy availability. PMID: 18702959

Show More

Hide All

Involvement in disease
Lipodystrophy, familial partial, 5 (FPLD5)
Subcellular Location
Nucleus. Endoplasmic reticulum. Lipid droplet. Note=Diffuses quickly on lipid droplet surface, but becomes trapped and clustered at lipid droplet contact sites, thereby enabling its rapid enrichment at lipid droplet contact sites.
Tissue Specificity
Expressed mainly in adipose tissue, small intestine, heart, colon and stomach and, at lower levels, in brain, kidney and liver.
Database Links

HGNC: 24229

OMIM: 612120

KEGG: hsa:63924

STRING: 9606.ENSP00000408631

UniGene: Hs.567562

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*