Recombinant Human Centrin-3(CETN3)

Code CSB-EP005266HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. O15182
Relevance Plays a fundamental role in microtubule-organizing center structure and function. Component of the TREX-2 complex (transcription and export complex 2), composed of at least ENY2, GANP, PCID2, DSS1, and either centrin CETN2 or CETN3. The TREX-2 complex functions in docking export-competent ribonucleoprotein particles (mRNPs) to the nuclear entrance of the nuclear pore complex (nuclear basket). TREX-2 participates in mRNA export and accurate chromatin positioning in the nucleus by tethering genes to the nuclear periphery
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFIAIMTGDI
Research Area Tags & Cell Markers
Source E.coli
Gene Names CETN3
Protein Names Recommended name: Centrin-3
Expression Region 1-167aa
Tag Info N-terminal GST-tagged
Mol. Weight 46.5kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plays a fundamental role in microtubule-organizing center structure and function.; FUNCTION
Subcellular Location Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, Nucleus, nucleolus, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole
Protein Families Centrin family
Database Links

HGNC: 1868

OMIM: 602907

KEGG: hsa:1070

STRING: 9606.ENSP00000283122

UniGene: Hs.591767

Related Products

CETN3 Antibodies

CETN3 Antibodies for Homo sapiens (Human)

CETN3 Antibodies for Human

CETN3 Proteins

CETN3 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.