Recombinant Human Clathrin heavy chain 1 (CLTC), partial

Code CSB-YP005593HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP005593HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP005593HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP005593HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP005593HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
Clathrin heavy chain 1; Clathrin heavy chain on chromosome 17; CLH-17; CLTC CLH17 CLTCL2 KIAA0034
Species
Homo sapiens (Human)
Expression Region
1-364
Target Protein Sequence
MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGAEELF
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Clathrin is the major protein of the polyhedral coat of coated pits and vesicles. Two different adapter protein complexes link the clathrin lattice either to the plasma membrane or to the trans-Golgi network. Acts as component of the TACC3/ch-TOG/clathrin complex proposed to contribute to stabilization of kinetochore fibers of the mitotic spindle by acting as inter-microtubule bridge. The TACC3/ch-TOG/clathrin complex is required for the maintenance of kinetochore fiber tension. Plays a role in early autophagosome formation.
Gene References into Functions
  1. Provide biochemical evidence for separate regulation and distinct functional niches for CHC17 and CHC22 in HeLa cells. Furthermore, the greater stability of the CHC22 coat relative to the CHC17 coat may be relevant to its excessive accumulation with GLUT4 during insulin resistance. PMID: 29097553
  2. this study shows that clathrin, including the clathrin population associated to internal vesicles, controls lymphocyte migration by regulating actin rearrangements occurring at the leading age PMID: 27405273
  3. The novel association of several endocytosis-associated proteins has been demonstrated, in particular, of CLTC and SCAMP3 with hepatocellular carcinoma progression. PMID: 27519163
  4. MiR-199a-5p suppresses tumorigenesis by targeting CLTC in hepatocellular carcinoma. PMID: 28261837
  5. SMAP2 immunoprecipitated clathrin and AP-1 through a putative clathrin-binding domain and a CALM-binding domain, and SMAP2 mutants that did not interact with clathrin or AP-1 could not localize to recycling endosomes PMID: 26136365
  6. The CHC:ESR1 interaction is required to sustain estradiol signaling. PMID: 25860340
  7. autophagy contributed to Cx31.1 degradation, and clathrin might be involved in the autophagy of Cx31.1. PMID: 25388970
  8. Data suggest that by binding to both clathrin and F-actin, mammalian actin-binding protein 1 (mAbp1; HIP-55 or SH3P7) is specifically recruited at a late stage of clathrin-coated pits (CCPs) formation, which subsequently recruits dynamin to CCPs. PMID: 25690657
  9. Our data support a model in which nascent Hepatits C Virus particles associate with apoE in the endoplasmic reticulum and exit cells following a clathrin-dependent transendosomal secretory route. PMID: 25631092
  10. These data indicate that clathrin is required for the function of AP-1- and GGA-coated carriers at the trans-Golgi network but may be dispensable for outward traffic en route to the plasma membrane. PMID: 24407285
  11. SNX9 and CHC function in the same molecular pathway for chromosome alignment and segregation, which is dependent on their direct association. PMID: 23861900
  12. clathrin interacts with Rab5 and plays a fundamental role in the entry and intracellular survival of B. abortus via interaction with lipid rafts and actin rearrangement PMID: 23940042
  13. High clathrin heavy chain expression promotes tumor pancreatic growth and angiogenesis through regulation of HIF-1alpha and VEGF signaling PMID: 23228632
  14. This study reveals a novel functional role of clathrin-coated structure in GMR signaling and the oncogenesis of JAK2V617F. PMID: 22935703
  15. The authors demonstrate that clathrin promotes clustering of the vaccinia virus actin tail nucleator A36 and host N-WASP, which activates actin nucleation through the Arp2/3 complex. PMID: 22980331
  16. Depletion of clathrin heavy chain (CHC)17, but not the CHC22 clathrin isoform, by ribonucleic acid interference (RNAi) induces centrosome amplification and multipolar spindles. PMID: 22891263
  17. Electron tomography reveals Rab6 is essential to the trafficking of trans-Golgi clathrin and COPI-coated vesicles and the maintenance of Golgi cisternal number PMID: 22335553
  18. These results indicate that Echovirus 7 is internalized by clathrin-mediated endocytosis. PMID: 22496312
  19. Postmitotic Golgi reassembly requires the clathrin heavy chain (CHC). PMID: 21965600
  20. is required for lamellipodium formation PMID: 22010197
  21. Our findings strongly suggest that clathrin and clathrin-mediated signaling pathways are involved in the inflammatory signal transduction of orbital fibroblasts in Graves ophthalmopathy. PMID: 21917865
  22. CHC functions as a built-in molecular brake that ensures a tight control of basal NF-kappaB activation and gene expression in unstimulated cells. PMID: 21364927
  23. Data suggest that clathrin's role in intermicrotubule bridging can be fulfilled not only by trimers but also by dimers, and that the membrane trafficking and mitotic functions of clathrin are independent and separable. PMID: 21362119
  24. The authors now report that the integrase domain of Gag-Pol is required for the incorporation of clathrin into HIV-1 virions. PMID: 21289110
  25. Clathrin is recruited to the mitotic spindle by TACC3 and ch-TOG. Together the complex forms inter-microtubule bridges in kinetochore fibres PMID: 21297582
  26. These data indicate that the endocytic uptake of the clostridial glucosylating toxins involves a dynamin-dependent process that is mainly governed by clathrin. PMID: 20498856
  27. Data show in mammalian cells that the heavy chain of clathrin interacts with Atg16L1 and is involved in the formation of Atg16L1-positive early autophagosome precursors. PMID: 20639872
  28. the association between aurora A phosphorylation and spindle apparatus; regulation from aurora A is mediated by CHC in recruiting phospho-TACC3 and subsequently ch-TOG to mitotic spindles. PMID: 20566684
  29. Endocytosis of FcalphaR is clathrin- and dynamin-dependent, but is not regulated by Rab5, and the endocytic motif is not located in the cytoplasmic domain of FcalphaR. PMID: 19859085
  30. neither clathrin nor AP-2 is essential for the internalization of epidermal growth factor PMID: 12960147
  31. Clathrin heavy chain phosphorylation and dephosphorylation are involved in TCR internalization; this is a regulatory mechanism linking TCR signaling to endocytosis. PMID: 15067034
  32. Nuclear CHC is required for the transactivation of p53 target genes and plays a distinct role from clathrin-mediated endocytosis. PMID: 16618797
  33. Syt I plays a pivotal role in mediating cAMP- and Ca(2+)-induced endocytosis of NHE3 (but not in inhibition of activity) through cargo recognition of NHE3 and subsequent recruitment of AP2-clathrin assembly required for membrane endocytosis. PMID: 17307723
  34. Results establish a role for the retromer complex in retrograde transport of the B-subunit of Shiga toxin, and strongly suggest that clathrin and retromer function in consecutive retrograde sorting steps on early endosomes. PMID: 17550971
  35. Nuclear CHC plays a role distinct from clathrin-mediated endocytosis. PMID: 17952123
  36. The clathrin inhibitor phenylarsine oxide prevented SubAB entry and BiP cleavage in SubAB-treated Vero, HeLa and N2A cells demonstrating that SubAB internalization is clathrin-dependent. PMID: 18042253
  37. cytosolic p53 may participate in the regulation of clathrin-mediated endocytosis to control the correct signaling from EGFR PMID: 18363968
  38. The endocytic clathrin machinery can internalize double-membrane vesicles into cells. PMID: 18656476
  39. Endocytosis of shiga toxin (Stx) in Ramos cells requires Syk activity and that Syk is recruited to the uptake site of Stx. PMID: 19289168
  40. Data compared each paralogue in functional assays of endocytosis and mitosis, and find that CHC17 and CHC22 are functionally equivalent. PMID: 19509056
  41. clathrin serving as a regulator of SNX4-dependent transport; upon clathrin release, dynein may bind SNX4 and mediate retrograde movement PMID: 19529763
  42. GAK and CHC cooperated in the same pathway and interacted in mitosis to regulate the formation of a functional spindle. PMID: 19654208
  43. Structural modeling analyses predict that an Asn1288 residue in CHC is crucial for binding to p53. In fact, substitution of this Asn to Ala of CHC diminished its ability to interact with p53, leading to reduced activity to transactivate p53. PMID: 19766654
  44. The assembly efficiency of the various hepatitis delta virus genotypes correlates well with the clathrin heavy chain-binding activity of their HDAg-Ls and coincides with the severity of disease outcome. PMID: 19793827

Show More

Hide All

Subcellular Location
Cytoplasmic vesicle membrane; Peripheral membrane protein; Cytoplasmic side. Membrane, coated pit; Peripheral membrane protein; Cytoplasmic side. Melanosome. Cytoplasm, cytoskeleton, spindle.
Protein Families
Clathrin heavy chain family
Database Links

HGNC: 2092

OMIM: 118955

KEGG: hsa:1213

STRING: 9606.ENSP00000269122

UniGene: Hs.491351

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×