Recombinant Human Complement C5 (C5), partial

Code	CSB-EP003995HU
Abbreviation	Recombinant Human C5 protein, partial
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Uniprot No.

P01031

Research Area

Signal Transduction

Alternative Names

Anaphylatoxin C5a analog; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4; C5; C5a anaphylatoxin; C5a; C5b; CO5_HUMAN; Complement C5 alpha'' chain; Complement C5; Complement component C5; CPAMD4; prepro-C5

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

678-751aa

Target Protein Sequence

TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLGR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

24.3kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Expand your research possibilities in signal transduction with our premium Recombinant Human Complement C5 (C5) protein. Complement C5, encoded by the C5 gene, is a crucial component of the immune system's complement cascade, influencing a wide range of biological processes, including inflammation, cell lysis, and chemotaxis.

This recombinant protein offers a partial representation of the human Complement C5, spanning the 678-751aa expression region. Expertly produced in E.coli, the protein is designed with an N-terminal 6xHis-SUMO tag for seamless purification and detection methods. Our Recombinant Human Complement C5 boasts a purity greater than 90%, as determined by SDS-PAGE, ensuring a high-quality product for your experiments. Available in both liquid and lyophilized powder forms, this protein offers versatility and convenience to researchers in the signal transduction field.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Activation of C5 by a C5 convertase initiates the spontaneous assembly of the late complement components, C5-C9, into the membrane attack complex. C5b has a transient binding site for C6. The C5b-C6 complex is the foundation upon which the lytic complex is assembled.; Derived from proteolytic degradation of complement C5, C5a anaphylatoxin is a mediator of local inflammatory process. Binding to the receptor C5AR1 induces a variety of responses including intracellular calcium release, contraction of smooth muscle, increased vascular permeability, and histamine release from mast cells and basophilic leukocytes. C5a is also a potent chemokine which stimulates the locomotion of polymorphonuclear leukocytes and directs their migration toward sites of inflammation.

Gene References into Functions

these data demonstrate that Mesenchymal Stem Cells inhibit the activation of pathogenic C5 via up-regulation of FH, which improves our understanding of the immunomodulatory mechanisms of MSCs in the treatment of lupus nephritis. PMID: 29885865
recombinant C5a potentiated TNFalpha-induced NF-kappaB activation in renal tubular epithelial cells PMID: 29031143
tumoral C5a is an independent adverse prognostic biomarker for clinical outcome of Clear Cell Renal Cell Carcinoma patients after nephectomy. PMID: 27381421
C5a synergises with P. aeruginosa LPS in both PD-L1 expression and the production of IL-10 and TGF-beta. PMID: 27624143
these results not only confirm the critical role of C5b-9 in complement-mediated hemolysis and but also highlight the critical role of C5b-9 in inflammasome activation. PMID: 27444648
Mean cerebrospinal fluid C5 levels increased in patients with depression and schizophrenia. PMID: 29454970
elevated in the cerebrospinal fluid of preterm newborns PMID: 27806664
Up-regulation of granulocyte and monocyte CD11b during plasma separation was C5-dependent. PMID: 29575196
This study provides the preclinical rationale for the combined blockade of PD-1/PD-L1 and C5a to restore antitumor immune responses, inhibit tumor cell growth, and improve outcomes of patients with lung cancer PMID: 28288993
Diagnosis and therapeutic management of neonatal hemochromatosis cannot only be based on C5b9 expression in liver samples as it is not specific of this disease. PMID: 28085791
C5a-C5aR enriched clear cell renal cell carcinoma patients significantly had a poorer overall survival and recurrence free survival after nephrectomy. PMID: 27821813
C5a/C5aR pathway promotes gastric cancer pathogenesis by suppressing p21/p-p21 expression via activation of PI3K/AKT signaling. PMID: 29031586
this study shows that C5 acts in the control of serum triglycerides and cholesterol, liver cholesterol deposition, liver homeostasis and C5 promotes a pro-inflammatory liver environment in our mouse model of alcoholic liver disease PMID: 26896155
a library of 61 peptides based on the C-terminus of C5a was assayed for the ability to selectively modulate C5aR2 function. PMID: 27108698
Data show the expression of a neoepitope which was exposed on complement C5 (C5) after binding to eculizumab in vivo. PMID: 28610663
Plasma levels of sC5b-9 were significantly increased in patients with thrombotic microangiopathy after allogeneic stem cell transplantation. PMID: 28801815
C5 gene analysis revealed two novel mutations as causative of C5 deficiency in 3 north African families PMID: 27026170
data indicate that properdin enhances platelet/granulocyte aggregates (PGAs) formation via increased production of C5a, and that inhibition of properdin function has therapeutic potential to limit thromboinflammation in diseases characterized by increased PGA formation PMID: 27183616
this study shows that complement C5a-induced changes in neutrophil morphology during inflammation PMID: 28671713
Increased C5a expression is associated with increased inflammation in cystic fibrosis. PMID: 28278205
Our results provide evidence that an intrinsic C5a generation may not be fully blocked by eculizumab in various disease settings. Controlling and fully blocking C5a induced signaling in humans therefore warrants a targeted approach PMID: 28366510
These findings, together with data from genomic variation databases, indicate a 0.5-2% prevalence of the Complement factor 5 (C5) p.A252T mutation in heterozygosity in sub-Saharan Africa. Therefore, this mutation may have a relevant role in meningococcal disease susceptibility in this geographical area. PMID: 28369827
we found the GG variant contributing to the risk of LAA-subtype ischemic stroke but were unable to find an association between ischemic stroke functional outcome at 90 days and C5 rs17611 variants. PMID: 27901252
this study shows that C5a signaling induces apoptosis in brain vascular endothelial cells in experimental lupus PMID: 27213693
We determined the genotypes of five polymorphisms (rs12237774, rs17611, rs4837805, rs7026551, and rs1017119) of C5 gene. In univariate analysis, rs17611 was significantly associated with Ischemic Stroke (IS) in the additive model, the dominant model, and recessive model. In this sample of patients, genetic variation of rs17611 in C5 is associated with higher prevalence of IS. PMID: 27768391
the complement anaphylatoxin C5a shows an inverse correlation with platelet bound oxLDL. The relationship of oxidized lipids to particular complement components may add to the platelet-lipid interplay in atherogenesis and trigger future clinical and mechanistic studies. PMID: 27025272
In an arterial thrombosis model, plasminogen activator administration increased C5a levels. Overall, these findings suggest plasmin bridges thrombosis and the immune response by liberating C5a and inducing MAC assembly. PMID: 27077125
C5 rs2269067 GG genotype confers risk for proliferative diabetic retinopathy of type 2 diabetes in Chinese Han population (associated with an elevated C5 mRNA expression and an increased IL-6 production) PMID: 26934706
C5a can induce the expression of TLR4 in retinal pigment epithelial cells. PMID: 26487798
elevated in the inflammatory lesions of placentas with villitis of unknown etiology PMID: 25725937
These results identify complement activation product C5a as a priming signal for RPE cells that allows for subsequent inflammasome activation by stimuli such as lipofuscin-mediated photooxidative damage. PMID: 26565031
a significant up-regulation (173 fold increase, p < 0.0001) in the expression of inflammatory complement component 5 (C5) in endometriosis was detected for the first time. PMID: 24316322
Complement C5b-9 complex sensitizes 661W photoreceptor cells to both apoptosis and necroptosis. PMID: 25735751
complement C5a signaling supports human stem cell pluripotency and survival, and thus may play a key role in shaping early human embryonic development PMID: 25132103
Rs2900180 in C5-TRAF1 and linked variants in a 66Kb region were associated with radiographic progression in ACPA-negative RA PMID: 25566937
The C5 rs2269067 GG genotype confers risk for AAU in a Chinese population and is associated with an elevated C5 serum concentration and an increased IL-17 production. PMID: 26230759
TRAF1/C5 rs10818488 polymorphism is not a genetic risk factor for acquired aplastic anemia in a Chinese population. PMID: 25500258
This study shows that individuals homozygously expressing the rheumatoid arthritis risk s17611 allele exhibit increased C5a and decreased C5 in plasma, evidence of increased C5 turnover. PMID: 25725109
Elevated sC5b-9 levels are indicative of active disease in atypical hemolytic uremic syndrome. PMID: 25818678
In conclusion, the present study indicates that C5a may promote the proliferation of breast cancer cells through Akt1 activation of the RGC-32 gene. PMID: 25230890
C5A is released from C5 by a cancer cell membrane bound serine protease which enchances neoplasm invasiveness, immune evasion, and neovascularization. PMID: 25050844
The interaction between S1P and C5a plays an important role in neutrophils for antineutrophil cytoplasmic antibody -mediated activation PMID: 25000985
Our data provide new insights into the regulatory role of C5a in PMN function during systemic C. albicans infection in human blood and identify C5a as an essential mediator of PMN activation in response to C. albicans. PMID: 25539819
This report includes seven affected families indicating that C5 deficiency is not rare in South Africa. PMID: 25534848
This study reveals that the C5 complement protein may play a critical role in mediating white matter injury through inflammation in the setting of chronic cerebral hypoperfusion. PMID: 24386419
the role of C5a as an endogenous priming signal that is required for the initiation of uric acid crystal-induced IL-1beta production. PMID: 25229885
Spontaneous abortion is associated with elevated systemic C5a and reduced mRNA of complement inhibitory proteins in placenta. PMID: 24802103
C5a, but not C5a-des Arg, was able to induce further heteromer formation between complement C5a receptors. PMID: 24060963
Data indicate that cholesterol crystals (CC) employed C5a in the release of IL-1beta. PMID: 24554772
Serum level of initiating complement factor (C1q) but not complement regulator C5 is deficient in schizophrenic patients. PMID: 23235303