Recombinant Human Complement C5 (C5), partial

In Stock
Code CSB-MP003995HU
Abbreviation Recombinant Human C5 protein, partial
MSDS
Size $440
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Anaphylatoxin C5a analog; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4; C5; C5a anaphylatoxin; C5a; C5b; CO5_HUMAN; Complement C5 alpha'' chain; Complement C5; Complement component C5; CPAMD4; prepro-C5
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
678-751aa
Target Protein Sequence
TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLGR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
12.3kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The production of the recombinant human complement C5 involves several steps. First, the gene fragment encoding the 678-751aa of C5 protein is isolated and co-inserted into a vector with the N-terminal 6xHis-Myc-tag gene. The vector acts as a carrier that delivers the targeted gene into mammalian cells for protein expression. The recombinant human C5 protein is extracted from the cell lysate and then purified through affinity chromatography. Its purity is over 90% as measured by SDS-PAGE.

Human Complement C5 is a vital component of the complement system, comprising two polypeptide chains, C5 alpha and C5 beta. C5 alpha can be further processed into C5 alpha' and C5a. It plays a significant role in complement-mediated diseases and immune responses [1][2][3]. Eculizumab, a humanized monoclonal antibody targeting C5, has been effectively used to manage complement-mediated diseases such as paroxysmal nocturnal hemoglobinuria (PNH) and atypical hemolytic uremic syndrome (aHUS) by inhibiting the cleavage of C5 into C5a and C5b [4][5][6]. Inhibition of C5 cleavage is a pivotal strategy in averting complement-mediated endothelial injury and thrombotic microangiopathy [7][8].

References:
[1] R. DiScipio, L. Jenner, S. Thirup, L. Sottrup-Jensen, J. Nyborg, & E. Stura, Crystallization of human complement component c5, Acta Crystallographica Section D Biological Crystallography, vol. 54, no. 4, p. 643-646, 1998. https://doi.org/10.1107/s0907444997015011
[2] T. Contractor, S. Kobayashi, E. Silva, R. Clausen, C. Chan, E. Vosburghet al., Sexual dimorphism of liver metastasis by murine pancreatic neuroendocrine tumors is affected by expression of complement c5, Oncotarget, vol. 7, no. 21, p. 30585-30596, 2016. https://doi.org/10.18632/oncotarget.8874
[3] N. Cooper and H. Müller‐Eberhard, The reaction mechanism of human c5 in immune hemolysis, The Journal of Experimental Medicine, vol. 132, no. 4, p. 775-793, 1970. https://doi.org/10.1084/jem.132.4.775
[4] L. Zhang, W. Qiao, S. Crooke, Y. Li, A. Abid, B. Xuet al., Development of autologous c5 vaccine nanoparticles to reduce intravascular hemolysis in vivo, Acs Chemical Biology, vol. 12, no. 2, p. 539-547, 2017. https://doi.org/10.1021/acschembio.6b00994
[5] S. Nandavaram, Thrombotic microangiopathy in solid organ transplantation, Obm Transplantation, vol. 08, no. 02, p. 1-37, 2024. https://doi.org/10.21926/obm.transplant.2402211
[6] C. Mache, B. Acham-Roschitz, V. Frémeaux‐Bacchi, M. Kirschfink, P. Zipfel, S. Roedlet al., Complement inhibitor eculizumab in atypical hemolytic uremic syndrome, Clinical Journal of the American Society of Nephrology, vol. 4, no. 8, p. 1312-1316, 2009. https://doi.org/10.2215/cjn.01090209
[7] A. Jin, L. Boroujerdi-Rad, G. Shah, & J. Chen, Thrombotic microangiopathy and human immunodeficiency virus in the era of eculizumab, Clinical Kidney Journal, vol. 9, no. 4, p. 576-579, 2016. https://doi.org/10.1093/ckj/sfw035
[8] L. Catanese, K. Link, & H. Rupprecht, Microangiopathy in multiple myeloma: a case of carfilzomib-induced secondary thrombotic microangiopathy successfully treated with plasma exchange and complement inhibition, BMC Nephrology, vol. 24, no. 1, 2023. https://doi.org/10.1186/s12882-023-03228-9

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Activation of C5 by a C5 convertase initiates the spontaneous assembly of the late complement components, C5-C9, into the membrane attack complex. C5b has a transient binding site for C6. The C5b-C6 complex is the foundation upon which the lytic complex is assembled.; Derived from proteolytic degradation of complement C5, C5a anaphylatoxin is a mediator of local inflammatory process. Binding to the receptor C5AR1 induces a variety of responses including intracellular calcium release, contraction of smooth muscle, increased vascular permeability, and histamine release from mast cells and basophilic leukocytes. C5a is also a potent chemokine which stimulates the locomotion of polymorphonuclear leukocytes and directs their migration toward sites of inflammation.
Gene References into Functions
  1. these data demonstrate that Mesenchymal Stem Cells inhibit the activation of pathogenic C5 via up-regulation of FH, which improves our understanding of the immunomodulatory mechanisms of MSCs in the treatment of lupus nephritis. PMID: 29885865
  2. recombinant C5a potentiated TNFalpha-induced NF-kappaB activation in renal tubular epithelial cells PMID: 29031143
  3. tumoral C5a is an independent adverse prognostic biomarker for clinical outcome of Clear Cell Renal Cell Carcinoma patients after nephectomy. PMID: 27381421
  4. C5a synergises with P. aeruginosa LPS in both PD-L1 expression and the production of IL-10 and TGF-beta. PMID: 27624143
  5. these results not only confirm the critical role of C5b-9 in complement-mediated hemolysis and but also highlight the critical role of C5b-9 in inflammasome activation. PMID: 27444648
  6. Mean cerebrospinal fluid C5 levels increased in patients with depression and schizophrenia. PMID: 29454970
  7. elevated in the cerebrospinal fluid of preterm newborns PMID: 27806664
  8. Up-regulation of granulocyte and monocyte CD11b during plasma separation was C5-dependent. PMID: 29575196
  9. This study provides the preclinical rationale for the combined blockade of PD-1/PD-L1 and C5a to restore antitumor immune responses, inhibit tumor cell growth, and improve outcomes of patients with lung cancer PMID: 28288993
  10. Diagnosis and therapeutic management of neonatal hemochromatosis cannot only be based on C5b9 expression in liver samples as it is not specific of this disease. PMID: 28085791
  11. C5a-C5aR enriched clear cell renal cell carcinoma patients significantly had a poorer overall survival and recurrence free survival after nephrectomy. PMID: 27821813
  12. C5a/C5aR pathway promotes gastric cancer pathogenesis by suppressing p21/p-p21 expression via activation of PI3K/AKT signaling. PMID: 29031586
  13. this study shows that C5 acts in the control of serum triglycerides and cholesterol, liver cholesterol deposition, liver homeostasis and C5 promotes a pro-inflammatory liver environment in our mouse model of alcoholic liver disease PMID: 26896155
  14. a library of 61 peptides based on the C-terminus of C5a was assayed for the ability to selectively modulate C5aR2 function. PMID: 27108698
  15. Data show the expression of a neoepitope which was exposed on complement C5 (C5) after binding to eculizumab in vivo. PMID: 28610663
  16. Plasma levels of sC5b-9 were significantly increased in patients with thrombotic microangiopathy after allogeneic stem cell transplantation. PMID: 28801815
  17. C5 gene analysis revealed two novel mutations as causative of C5 deficiency in 3 north African families PMID: 27026170
  18. data indicate that properdin enhances platelet/granulocyte aggregates (PGAs) formation via increased production of C5a, and that inhibition of properdin function has therapeutic potential to limit thromboinflammation in diseases characterized by increased PGA formation PMID: 27183616
  19. this study shows that complement C5a-induced changes in neutrophil morphology during inflammation PMID: 28671713
  20. Increased C5a expression is associated with increased inflammation in cystic fibrosis. PMID: 28278205
  21. Our results provide evidence that an intrinsic C5a generation may not be fully blocked by eculizumab in various disease settings. Controlling and fully blocking C5a induced signaling in humans therefore warrants a targeted approach PMID: 28366510
  22. These findings, together with data from genomic variation databases, indicate a 0.5-2% prevalence of the Complement factor 5 (C5) p.A252T mutation in heterozygosity in sub-Saharan Africa. Therefore, this mutation may have a relevant role in meningococcal disease susceptibility in this geographical area. PMID: 28369827
  23. we found the GG variant contributing to the risk of LAA-subtype ischemic stroke but were unable to find an association between ischemic stroke functional outcome at 90 days and C5 rs17611 variants. PMID: 27901252
  24. this study shows that C5a signaling induces apoptosis in brain vascular endothelial cells in experimental lupus PMID: 27213693
  25. We determined the genotypes of five polymorphisms (rs12237774, rs17611, rs4837805, rs7026551, and rs1017119) of C5 gene. In univariate analysis, rs17611 was significantly associated with Ischemic Stroke (IS) in the additive model, the dominant model, and recessive model. In this sample of patients, genetic variation of rs17611 in C5 is associated with higher prevalence of IS. PMID: 27768391
  26. the complement anaphylatoxin C5a shows an inverse correlation with platelet bound oxLDL. The relationship of oxidized lipids to particular complement components may add to the platelet-lipid interplay in atherogenesis and trigger future clinical and mechanistic studies. PMID: 27025272
  27. In an arterial thrombosis model, plasminogen activator administration increased C5a levels. Overall, these findings suggest plasmin bridges thrombosis and the immune response by liberating C5a and inducing MAC assembly. PMID: 27077125
  28. C5 rs2269067 GG genotype confers risk for proliferative diabetic retinopathy of type 2 diabetes in Chinese Han population (associated with an elevated C5 mRNA expression and an increased IL-6 production) PMID: 26934706
  29. C5a can induce the expression of TLR4 in retinal pigment epithelial cells. PMID: 26487798
  30. elevated in the inflammatory lesions of placentas with villitis of unknown etiology PMID: 25725937
  31. These results identify complement activation product C5a as a priming signal for RPE cells that allows for subsequent inflammasome activation by stimuli such as lipofuscin-mediated photooxidative damage. PMID: 26565031
  32. a significant up-regulation (173 fold increase, p < 0.0001) in the expression of inflammatory complement component 5 (C5) in endometriosis was detected for the first time. PMID: 24316322
  33. Complement C5b-9 complex sensitizes 661W photoreceptor cells to both apoptosis and necroptosis. PMID: 25735751
  34. complement C5a signaling supports human stem cell pluripotency and survival, and thus may play a key role in shaping early human embryonic development PMID: 25132103
  35. Rs2900180 in C5-TRAF1 and linked variants in a 66Kb region were associated with radiographic progression in ACPA-negative RA PMID: 25566937
  36. The C5 rs2269067 GG genotype confers risk for AAU in a Chinese population and is associated with an elevated C5 serum concentration and an increased IL-17 production. PMID: 26230759
  37. TRAF1/C5 rs10818488 polymorphism is not a genetic risk factor for acquired aplastic anemia in a Chinese population. PMID: 25500258
  38. This study shows that individuals homozygously expressing the rheumatoid arthritis risk s17611 allele exhibit increased C5a and decreased C5 in plasma, evidence of increased C5 turnover. PMID: 25725109
  39. Elevated sC5b-9 levels are indicative of active disease in atypical hemolytic uremic syndrome. PMID: 25818678
  40. In conclusion, the present study indicates that C5a may promote the proliferation of breast cancer cells through Akt1 activation of the RGC-32 gene. PMID: 25230890
  41. C5A is released from C5 by a cancer cell membrane bound serine protease which enchances neoplasm invasiveness, immune evasion, and neovascularization. PMID: 25050844
  42. The interaction between S1P and C5a plays an important role in neutrophils for antineutrophil cytoplasmic antibody -mediated activation PMID: 25000985
  43. Our data provide new insights into the regulatory role of C5a in PMN function during systemic C. albicans infection in human blood and identify C5a as an essential mediator of PMN activation in response to C. albicans. PMID: 25539819
  44. This report includes seven affected families indicating that C5 deficiency is not rare in South Africa. PMID: 25534848
  45. This study reveals that the C5 complement protein may play a critical role in mediating white matter injury through inflammation in the setting of chronic cerebral hypoperfusion. PMID: 24386419
  46. the role of C5a as an endogenous priming signal that is required for the initiation of uric acid crystal-induced IL-1beta production. PMID: 25229885
  47. Spontaneous abortion is associated with elevated systemic C5a and reduced mRNA of complement inhibitory proteins in placenta. PMID: 24802103
  48. C5a, but not C5a-des Arg, was able to induce further heteromer formation between complement C5a receptors. PMID: 24060963
  49. Data indicate that cholesterol crystals (CC) employed C5a in the release of IL-1beta. PMID: 24554772
  50. Serum level of initiating complement factor (C1q) but not complement regulator C5 is deficient in schizophrenic patients. PMID: 23235303

Show More

Hide All

Involvement in disease
Complement component 5 deficiency (C5D)
Subcellular Location
Secreted.
Database Links

HGNC: 1331

OMIM: 120900

KEGG: hsa:727

STRING: 9606.ENSP00000223642

UniGene: Hs.494997

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*