Recombinant Human Cubilin (CUBN), partial

Code CSB-EP006213HU
Abbreviation Recombinant Human CUBN protein, partial
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
CUBN
Uniprot No.
Research Area
Metabolism
Alternative Names
460 kDa receptor;Intestinal intrinsic factor receptor;Intrinsic factor-cobalamin receptor;Intrinsic factor-vitamin B12 receptor
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
110-347aa
Target Protein Sequence
IYQLNSKLVDLERKFQGLQQTVDKKVCSSNPCQNGGTCLNLHDSFFCICPPQWKGPLCSADVNECEIYSGTPLSCQNGGTCVNTMGSYSCHCPPETYGPQCASKYDDCEGGSVARCVHGICEDLMREQAGEPKYSCVCDAGWMFSPNSPACTLDRDECSFQPGPCSTLVQCFNTQGSFYCGACPTGWQGNGYICEDINECEINNGGCSVAPPVECVNTPGSSHCQACPPGYQGDGRVC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
32.4 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Endocytic receptor which plays a role in lipoprotein, vitamin and iron metabolism by facilitating their uptake. Acts together with LRP2 to mediate endocytosis of high-density lipoproteins, GC, hemoglobin, ALB, TF and SCGB1A1. Acts together with AMN to mediate endocytosis of the CBLIF-cobalamin complex. Binds to ALB, MB, Kappa and lambda-light chains, TF, hemoglobin, GC, SCGB1A1, APOA1, high density lipoprotein, and the CBLIF-cobalamin complex. Ligand binding requires calcium. Serves as important transporter in several absorptive epithelia, including intestine, renal proximal tubules and embryonic yolk sac. May play an important role in the development of the peri-implantation embryo through internalization of APOA1 and cholesterol. Binds to LGALS3 at the maternal-fetal interface.
Gene References into Functions
  1. Study shows that cubilin mutations (novel and some previously reported) and all previously reported amnionless missense mutations resulted in endoplasmic reticulum retention and completely inhibited amnionless-dependent plasma membrane expression of cubilin. PMID: 29402915
  2. in teens with positive recto-vaginal group B streptococcus colonization, placental mRNA expression of cubilin is lower compared to those who tested negative for this infection PMID: 28622535
  3. Cubilin is involved in 25(OH) vitamin D uptake by adipocytes. PMID: 29186386
  4. Study identified CUBN as a marker for risk stratification of patients with renal cell carcinoma (RCC). Lack of CUBN expression was significantly associated with early disease progression and poor patient outcome, independent of T-stage, Fuhrman grade and nodal status. Owing to a highly RCC-specific expression profile, CUBN expression also has a potential role in clinical cancer differential diagnostics. PMID: 28052770
  5. CUBN SNP rs1801239 (I2984V), previously associated with albuminuria, was significantly associated with T2D-ESRD in blacks. PMID: 27197912
  6. Tumoral expression of cubilin is a positive predictive marker for treatment of metastatic renal cell cancer patients with sunitinib and sorafenib. PMID: 28260162
  7. The CUBN haplotypes were associated with an altered gastric cancer risk. PMID: 26959381
  8. CUBN was associated with albuminuria in type 2 diabetes patients. PMID: 26631737
  9. The variant rs11254363 of the CUBN gene was associated with a decreased risk of developing congenital heart disease in Han Chinese populations PMID: 24533076
  10. MA is associated with CVD irrespective of the presence of the CUBN risk allele. These results challenge the concept that albuminuria in the setting of this mutation is benign. PMID: 24052458
  11. Cubilin haploinsufficiency leads to reduced renal proximal tubular uptake of albumin and apolipoprotein (apo)A-I, significantly increasing urinary loss of albumin and apoA-I. PMID: 24357674
  12. predisposition to multibacillary leprosy in Vietnam is associated with CUBN and NEBL common variants in the chromosome 10p13 linkage region PMID: 24563210
  13. LOS treatment decreased microalbuminuria induced by Cd apparently through a cubilin receptor-dependent mechanism but independent of megalin. PMID: 24093454
  14. Data suggest that endodermal layer of yolk sac and syncytiotrophoblast/cytotrophoblast cells of placental villi express cubilin mRNA/protein; expression of cubilin mRNA/protein is up-regulated as gestation/placentation progresses. PMID: 23978537
  15. The p.I1e2984Val variant of cubulin is part of a larger haplotype in European populations that is almost absent in West Africans. PMID: 23114252
  16. Single nucleotide polymorphisms in cubilin gene is associated with iron overload. PMID: 22761678
  17. These data suggest that CUBN is not involved in cleft lip or palate onset in the investigated Italian population PMID: 21781439
  18. Our genetic screening of 154 families of patients with inherited cobalamin malabsorption revealed population-specific mutations, mutational hotspots, and functionally distinct regions in the three causal genes: CUBN, AMN, and GIF. PMID: 22929189
  19. used immunocytochemistry and reverse transcription-polymerase chain reaction on laser-captured glomeruli to demonstrate synthesis and expression of cubilin in glomerular podocytes PMID: 22337902
  20. Expression of megalin and cubilin is decreased during experimental endotoxemia, which may contribute to an increase in urine levels of albumin during acute renal failure. PMID: 22437417
  21. CUBN rs7918972 as a novel risk variant for renal function loss PMID: 22574174
  22. amnionless is essential for the correct luminal expression of cubilin in humans. PMID: 21750092
  23. A novel 1-bp homozygous deletion of the cubilin was found to be the cause of proteinuria with nephrotic syndrome. PMID: 21903995
  24. megalin and cubilin are involved in the metabolism of vitamin D by reabsorbing vitamin D binding protein; dysfunction of these receptors is likely to be associated with the development of vitamin D deficiency in patients with chronic kidney disease PMID: 21595846
  25. There is a missense CUBN variant that associates with levels of albuminuria in both the general population and in individuals with diabetes. PMID: 21355061
  26. cubilin gene polymorphisms have an influence on 25(OH)D3 and 1,25(OH)2D3 plasma levels in type 1 diabetes patients PMID: 20398757
  27. crystal structure of the complex between IF-Cbl and the cubilin IF-Cbl-binding-region (CUB(5-8)) determined at 3.3 A resolution PMID: 20237569
  28. Comparative analysis of cobalamin binding kinetics PMID: 11788601
  29. Megalin and cubilin: multifunctional endocytic receptors. A review. PMID: 11994745
  30. proteinuria was due to the lack of cubilin function needed for tubular reabsorption of some, but not all, proteins of the primary urine. PMID: 12687456
  31. cubilin and amnionless are subunits of a novel cubilin/amnionless (cubam) complex PMID: 14576052
  32. the early cubilin expression and its function in protein and cholesterol uptake suggest an important role for cubilin in the development of the peri-implantation embryo PMID: 15616221
  33. Formation of the cubilin recognition site on intrinsic factor (IF) is caused by assembly of two distant domains, which allows the saturated IF protein to be recognized by the receptor. PMID: 15736970
  34. interactions of COBALAMIN BINDING proteins with a number of ligands PMID: 17487979
  35. This review summarizes recent data on the biological function of cubilin and focuses on its implication in embryonic nutrition and central nervous system malformations. PMID: 17979745
  36. light chain endocytosis is predominantly mediated by the megalin-cubilin tandem endocytic receptor and identify endocytosis as a key step in light chain cytotoxicity. PMID: 18448595
  37. results show different expression patterns of megalin and cubulin in calculous gallbladders and acalculous gallbladders suggesting an association with gallstone formation and implying a putative role of the two proteins in cholesterol endocytosis PMID: 18791690
  38. An association study of 45 folate-related genes in spina bifida: Involvement of cubilin PMID: 19161160
  39. Aberrant shedding of megalin and cubilin may contribute to albuminuria in diabetes and to deficiency states of important vitamins and hormones. PMID: 19366958

Show More

Hide All

Involvement in disease
Recessive hereditary megaloblastic anemia 1 (RH-MGA1)
Subcellular Location
Apical cell membrane; Peripheral membrane protein. Cell membrane; Peripheral membrane protein. Membrane, coated pit. Endosome. Lysosome membrane; Peripheral membrane protein.
Tissue Specificity
Detected in kidney cortex (at protein level). Expressed in kidney proximal tubule cells, placenta, visceral yolk-sac cells and in absorptive intestinal cells. Expressed in the epithelium of intestine and kidney.
Database Links

HGNC: 2548

OMIM: 261100

KEGG: hsa:8029

STRING: 9606.ENSP00000367064

UniGene: Hs.166206

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*