Recombinant Human Cysteine-rich protein 1 (CRIP1), partial

In Stock
Code CSB-EP005969HU
Abbreviation Recombinant Human CRIP1 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
CRIP1
Uniprot No.
Research Area
Signal Transduction
Alternative Names
CRHP; CRIP; CRIP1; CRIP1_HUMAN; CRP-1; CRP1; Cysteine rich heart protein; Cysteine rich intestinal protein; Cysteine rich protein 1 (intestinal); Cysteine rich protein 1; Cysteine-rich heart protein; Cysteine-rich intestinal protein; Cysteine-rich protein 1; FLJ40971; hCRHP
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-77aa
Target Protein Sequence
PKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTFK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
35.4kDa
Protein Length
Partial
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Seems to have a role in zinc absorption and may function as an intracellular zinc transport protein.
Gene References into Functions
  1. CRIP1 promotes cell migration and invasion, mediates epithelial-mesenchymal transition, and activates the Wnt/betacatenin signaling pathway in cervical cancer PMID: 29959029
  2. CRIP1 acts as an oncogene in the cell proliferation, migration, and invasion processes of thyroid carcinoma. CRIP1 may serve well as an independent prognostic marker with significant predictive power for use in thyroid carcinoma therapy. PMID: 29059670
  3. The CRIP1 expression level was highest in the highly metastatic colon cancer cell lines and CRIP1 silencing did not significantly affect the percentage of apoptotic SW620 and HT29 cells. PMID: 29179181
  4. CRIP1 gene expression was correlated to measures of cardiac hypertrophy in Hypertension patients. Assessment of circulating CRIP1 (cystein-rich protein 1) levels as biomarkers showed a strong association with increased risk for incident stroke. PMID: 28784648
  5. This study provides evidence for a prognostic clinical potential of the combined study of GAL-3 and CRIP-1 in endometrial cancer PMID: 26708131
  6. CRIP1 expression is associated with long-term survival and no metastases in osteosarcoma patients. PMID: 22202598

Show More

Hide All

Database Links

HGNC: 2360

OMIM: 123875

KEGG: hsa:1396

STRING: 9606.ENSP00000455329

UniGene: Hs.70327

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*