Recombinant Human Cysteine-rich protein 1(CRIP1)

Code CSB-EP005969HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P50238
Relevance Seems to have a role in zinc absorption and may function as an intracellular zinc transport protein.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Cysteine-rich heart protein
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence PKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTFK
Research Area Signal Transduction
Source E.coli
Gene Names CRIP1
Protein Names Recommended name: Cysteine-rich protein 1 Short name= CRP-1 Alternative name(s): Cysteine-rich heart protein Short name= CRHP Short name= hCRHP Cysteine-rich intestinal protein Short name= CRIP
Expression Region 1-77aa
Tag Info N-terminal GST-tagged
Mol. Weight 35.4kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Seems to have a role in zinc absorption and may function as an intracellular zinc transport protein.
Database Links

HGNC: 2360

OMIM: 123875

KEGG: hsa:1396

STRING: 9606.ENSP00000455329

UniGene: Hs.70327

Related Products

CRIP1 Antibodies

CRIP1 Antibodies for Human

CRIP1 Proteins

CRIP1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.