Recombinant Human Cysteine-rich protein 1(CRIP1)

Code CSB-EP005969HU
Size US$1726
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names CRIP1
Uniprot No. P50238
Research Area Signal Transduction
Alternative Names CRHP; CRIP; CRIP1; CRIP1_HUMAN; CRP-1; CRP1; Cysteine rich heart protein; Cysteine rich intestinal protein; Cysteine rich protein 1 (intestinal); Cysteine rich protein 1; Cysteine-rich heart protein; Cysteine-rich intestinal protein; Cysteine-rich protein 1; FLJ40971; hCRHP
Species Homo sapiens (Human)
Source E.coli
Expression Region 1-77aa
Target Protein Sequence PKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTFK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 35.4kDa
Protein Length Full Length
Tag Info N-terminal GST-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Seems to have a role in zinc absorption and may function as an intracellular zinc transport protein.
Gene References into Functions
  1. CRIP1 promotes cell migration and invasion, mediates epithelial-mesenchymal transition, and activates the Wnt/betacatenin signaling pathway in cervical cancer PMID: 29959029
  2. CRIP1 acts as an oncogene in the cell proliferation, migration, and invasion processes of thyroid carcinoma. CRIP1 may serve well as an independent prognostic marker with significant predictive power for use in thyroid carcinoma therapy. PMID: 29059670
  3. The CRIP1 expression level was highest in the highly metastatic colon cancer cell lines and CRIP1 silencing did not significantly affect the percentage of apoptotic SW620 and HT29 cells. PMID: 29179181
  4. CRIP1 gene expression was correlated to measures of cardiac hypertrophy in Hypertension patients. Assessment of circulating CRIP1 (cystein-rich protein 1) levels as biomarkers showed a strong association with increased risk for incident stroke. PMID: 28784648
  5. This study provides evidence for a prognostic clinical potential of the combined study of GAL-3 and CRIP-1 in endometrial cancer PMID: 26708131
  6. CRIP1 expression is associated with long-term survival and no metastases in osteosarcoma patients. PMID: 22202598

Show More

Hide All

Database Links

HGNC: 2360

OMIM: 123875

KEGG: hsa:1396

STRING: 9606.ENSP00000455329

UniGene: Hs.70327

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1