Recombinant Human Cytochrome P450 4A11 (CYP4A11)

Code CSB-YP5726HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP5726HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP5726HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP5726HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP5726HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
Cytochrome P450 4A11; EC 1.14.14.1; 20-hydroxyeicosatetraenoic acid synthase; 20-HETE synthase; CYP4AII; CYPIVA11; Cytochrome P-450HK-omega; Cytochrome P450HL-omega; Fatty acid omega-hydroxylase; Lauric acid omega-hydroxylase; Long-chain fatty acid omega-monooxygenase; EC 1.14.14.80; CYP4A11 CYP4A2
Species
Homo sapiens (Human)
Expression Region
5-519
Target Protein Sequence
VLSPSRLLGDVSGILQAASLLILLLLLIKAVQLYLHRQWLLKALQQFPCPPSHWLFGHIQELQQDQELQRIQKWVETFPSACPHWLWGGKVRVQLYDPDYMKVILGRSDPKSHGSYRFLAPWIGYGLLLLNGQTWFQHRRMLTPAFHYDILKPYVGLMADSVRVMLDKWEELLGQDSPLEVFQHVSLMTLDTIMKCAFSHQGSIQVDRNSQSYIQAISDLNNLVFSRVRNAFHQNDTIYSLTSAGRWTHRACQLAHQHTDQVIQLRKAQLQKEGELEKIKRKRHLDFLDILLLAKMENGSILSDKDLRAEVDTFMFEGHDTTASGISWILYALATHPKHQERCREEIHSLLGDGASITWNHLDQMPYTTMCIKEALRLYPPVPGIGRELSTPVTFPDGRSLPKGIMVLLSIYGLHHNPKVWPNPEVFDPFRFAPGSAQHSHAFLPFSGGSRNCIGKQFAMNELKVATALTLLRFELLPDPTRIPIPIARLVLKSKNGIHLRLRRLPNPCEDKDQL
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
A cytochrome P450 monooxygenase involved in the metabolism of fatty acids and their oxygenated derivatives (oxylipins). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (CPR; NADPH-ferrihemoprotein reductase). Catalyzes predominantly the oxidation of the terminal carbon (omega-oxidation) of saturated and unsaturated fatty acids, the catalytic efficiency decreasing in the following order: dodecanoic > tetradecanoic > (9Z)-octadecenoic > (9Z,12Z)-octadecadienoic > hexadecanoic acid. Acts as a major omega-hydroxylase for dodecanoic (lauric) acid in liver. Participates in omega-hydroxylation of (5Z,8Z,11Z,14Z)-eicosatetraenoic acid (arachidonate) to 20-hydroxyeicosatetraenoic acid (20-HETE), a signaling molecule acting both as vasoconstrictive and natriuretic with overall effect on arterial blood pressure. Can also catalyze the oxidation of the penultimate carbon (omega-1 oxidation) of fatty acids with lower efficiency. May contribute to the degradation of saturated very long-chain fatty acids (VLCFAs) such as docosanoic acid, by catalyzing successive omega-oxidations to the corresponding dicarboxylic acid, thereby initiating chain shortening. Omega-hydroxylates (9R,10S)-epoxy-octadecanoate stereoisomer. Plays a minor role in omega-oxidation of long-chain 3-hydroxy fatty acids. Has little activity toward prostaglandins A1 and E1.
Gene References into Functions
  1. Haplotype G-C-A of CYP4A11 was associated with increased risk of coronary artery disease. PMID: 29484037
  2. Gene-gene interaction between rs1126742 and rs3890011 and gene-environment interaction between rs1126742 and smoking were associated with increased EH risk. PMID: 28534704
  3. Heme-thiolate sulfenylation of human cytochrome P450 4A11 functions as a redox switch for catalytic inhibition. PMID: 28533430
  4. These results point to a potential 20-HETE dependence of intrarenal angiotensinogen production and ANGII receptor type 1 activation that are associated with increases in NCC and SGK1 and identify elevated P450 4A11 activity and 20-HETE as potential risk factors for salt-sensitive human hypertension by perturbation of the renal renin-angiotensin axis. PMID: 27298316
  5. CYP4A11 Variants are associated with Ischemic Stroke. PMID: 27087514
  6. The results suggest that individuals carrying the alleles, K276T and S353G, might exhibit higher catalysis of CYP4A11 PMID: 27793475
  7. CYP4A1l rs9333025 GG and CYP4F2 rs2108622 GG two-loci interaction significantly increases the risk for IS and an elevated 20-HETE level. PMID: 26959478
  8. Single nucleotide polymorphism of CYP4A11 gene is associated with Plaque in Patients with Ischemic Stroke. PMID: 26423716
  9. The present study focused on 10 CYP4A11 variant alleles and evaluated their functional characteristics using arachidonic acid as the substrate in a COS-7 cell-based expression system. PMID: 25760539
  10. To evaluate the associations between four single-nucleotide polymorphisms (SNPs) in CYP4A11 and CYP4F2 and ischemic stroke (IS) PMID: 25734770
  11. The CC genotype and C allele of the CYP4A11 gene were associated with essential hypertension in the male western Chinese Han population. PMID: 24164311
  12. individuals homozygous for the CYP4A11 rs3890011 C allele, blood pressure is resistant to mineralocorticoid receptor antagonism, but sensitive to ENaC inhibition, consistent with ENaC activation. PMID: 25064769
  13. Results indicate that both the transfer of an electron to the ferrous.O2 complex and C-H bond-breaking limit the rate of CYP4A11 ( cytochrome P450 4A11) omega-oxidation. PMID: 25203493
  14. This meta-analysis suggests the CYP4A11 T8590C polymorphism may be a risk factor for hypertension. PMID: 24931260
  15. suggests there is a significant association between the CYP4A11 T8590C variant and essential hypertension, especially in Caucasians. The case-control study did not find a significant association among the Han Chinese population PMID: 24278241
  16. The results suggest that the CYP4A11 GG genotype was a high risk factor for hypertension. PMID: 24535879
  17. This meta-analysis revealed that the RGS2 1891-1892del TC polymorphism and CYP4A11 T8590C polymorphism were associated with hypertension risk. PMID: 23859711
  18. The CYP4A11 8590C allele was also associated with low HDL-C in women. PMID: 21912424
  19. rs3890011 maybe a novel polymorphism of the CYP4A11 gene associated with CAD in a Han Chinese population. PMID: 22327816
  20. The GG genotype of rs3890011 and the G-G-T haplotype in the CYP4A11 gene could be a useful genetic marker of CAD in Han populations in China. PMID: 23085321
  21. Single-nucleotide polymorphisms of the human CYP4A11 gene appear to have no association with myocardial infarction in Japanese. PMID: 22804341
  22. We confirmed that the CYP4A11 (8590T>C) functional polymorphism exhibits inter-ethnic frequency differences and an association with hypertension. PMID: 21617944
  23. The loss-of-function CYP4A11 8590C allele is associated with a diagnosis of hypertension and, in normotensive individuals, with higher blood pressure regardless of salt intake. PMID: 21873888
  24. Data suggest that results could be helpful for further investigations of the potential role of CYP4A variants in the genetic susceptibility to cardiovascular diseases such as arterial hypertension. PMID: 21820496
  25. In normotensive individuals, the CYP4A11 rs4660980 polymophism was associated with both systolic and diastolic blood pressure in men. A common variant on CYP4A11 was associated with blood pressure in a Chinese population. PMID: 21326303
  26. Association of common variants of CYP4A11 with stroke in Han Chinese population is reported. PMID: 20130494
  27. In patients with established and stable coronary artery disease the 434SS variant of CYP4A11 F434 is associated with pronounced coronary vasoconstriction. PMID: 19615687
  28. CYP4A11 expression can be induced by glucocorticoids and peroxisome proliferators PMID: 12464261
  29. gene and protein analysis of CYP4A11 show that it is expressed in kidney PMID: 12464262
  30. A variant of the human CYP4A11 (T8590C) encodes for a monooxygenase with reduced 20-HETE synthase activity. The association of the T8590C variant with hypertension supports its role as a polygenic determinant of blood pressure control in humans. PMID: 15611369
  31. Our data strengthen the association between the T8590C polymorphism of CYP4A11 and hypertension and suggest a recessive mode of inheritance. PMID: 16144986
  32. Genetic (T8590C) and environmental (insulin) factors impair 20-HETE responses to salt in human hypertension. The T8590C polymorphism of CYP4A11 encodes an enzyme with reduced catalytic activity. PMID: 18227405
  33. Essential hypertension is associated with the TC + TT genotype of rs1126742 in the human CYP4A11 gene PMID: 18300855
  34. The CYP4A11 8590CC genotype is associated with increased blood pressure in black men with hypertensive nephrosclerosis and is associated with adverse clinical outcomes in those with baseline proteinuria. PMID: 18385420
  35. In humans that polymorphisms of the CYP4F2 and CYP4A11 genes have opposite effects on 20-hydroxyeicosatetraenoic acid excretion. PMID: 18391101
  36. a functional variant (-845A/G) of CYP4A11 is significantly associated with hypertension and appears to be a novel candidate for a predisposing factor for hypertension PMID: 18936345
  37. PPARalpha contributes to the maintenance of basal CYP4A11 expression and mediates CYP4A11 induction in response to fibrates or fasting; increased exposure to growth hormone down-regulates CYP4A11 expression in liver PMID: 19366684

Show More

Hide All

Subcellular Location
Endoplasmic reticulum membrane; Peripheral membrane protein. Microsome membrane; Peripheral membrane protein.
Protein Families
Cytochrome P450 family
Tissue Specificity
Expressed in liver. Expressed in S2 and S3 segments of proximal tubules in cortex and outer medulla of kidney.
Database Links

HGNC: 2642

OMIM: 601310

KEGG: hsa:1579

STRING: 9606.ENSP00000311095

UniGene: Hs.1645

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1