Recombinant Human Cytochrome c oxidase subunit 7A-related protein, mitochondrial(COX7A2L)

Code CSB-EP005862HU
Size US$2466
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names COX7A2L
Uniprot No. O14548
Research Area Signal Transduction
Alternative Names COX7a related protein; COX7a-related protein; COX7A2L; COX7AR; COX7R_HUMAN; COX7RP; Cytochrome c oxidase subunit 7A-related protein; cytochrome c oxidase subunit 7A-related protein; mitochondrial; Cytochrome c oxidase subunit 7A2 like; cytochrome c oxidase subunit VII-related protein; cytochrome c oxidase subunit VIIa polypeptide 2 like; Cytochrome c oxidase subunit VIIa related protein; mitochondrial; Cytochrome c oxidase subunit VIIa-related protein; EB1; Estrogen receptor binding CpG island; mitochondrial; SIG81
Species Homo sapiens (Human)
Source E.coli
Expression Region 1-114aa
Target Protein Sequence MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 39.6kDa
Protein Length Full Length
Tag Info N-terminal GST-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Involved in the regulation of oxidative phosphorylation and energy metabolism (By similarity). Necessary for the assembly of mitochondrial respiratory supercomplex (By similarity).
Gene References into Functions
  1. COX7AR is a stress-inducible mitochondrial COX subunit that facilitates human breast cancer malignancy PMID: 27550821
  2. COX7A2L is a mitochondrial complex III binding protein that stabilizes the III2+iv supercomplex without affecting respirasome formation. PMID: 27545886
  3. Novel insights into the assembly and function of human nuclear-encoded cytochrome c oxidase subunits 7a PMID: 20307258
Subcellular Location Mitochondrion inner membrane
Protein Families Cytochrome c oxidase VIIa family
Database Links

HGNC: 2289

OMIM: 605771

KEGG: hsa:9167

STRING: 9606.ENSP00000234301

UniGene: Hs.339639

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1