Recombinant Human Cytochrome c oxidase subunit 7A-related protein, mitochondrial(COX7A2L)

Code CSB-EP005862HU
Product Type Recombinant Protein
Size US$2466
Uniprot No. O14548
Relevance Involved in the regulation of oxidative phosphorylation and energy metabolism. Necessary for the assembly of mitochondrial respiratory supercomplex
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias COX7a-related protein Cytochrome c oxidase subunit VIIa-related protein EB1
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK
Research Area Signal Transduction
Source E.coli
Gene Names COX7A2L
Protein Names Recommended name: Cytochrome c oxidase subunit 7A-related protein, mitochondrialAlternative name(s): COX7a-related protein Cytochrome c oxidase subunit VIIa-related protein EB1
Expression Region 1-114aa
Tag Info N-terminal GST-tagged
Mol. Weight 39.6kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in the regulation of oxidative phosphorylation and energy metabolism (By similarity). Necessary for the assembly of mitochondrial respiratory supercomplex (By similarity).
Subcellular Location Mitochondrion inner membrane
Protein Families Cytochrome c oxidase VIIa family
Database Links

HGNC: 2289

OMIM: 605771

KEGG: hsa:9167

STRING: 9606.ENSP00000234301

UniGene: Hs.339639

Pathway Cardiac muscle contraction
Oxidative Phosphorylation

Related Products

COX7A2L Antibodies

COX7A2L Antibodies for Homo sapiens (Human)

COX7A2L Antibodies for Human

COX7A2L Proteins

COX7A2L Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.