Recombinant Human DNA-directed RNA polymerase I subunit RPA12 (ZNRD1)

Code CSB-EP885791HU
Abbreviation Recombinant Human ZNRD1 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
ZNRD1
Uniprot No.
Research Area
Transcription
Alternative Names
DNA directed RNA polymerase I subunit RPA12; DNA-directed RNA polymerase I subunit RPA12; HTEX 6; hZR14; RNA polymerase I small specific subunit Rpa12; RPA12; RPA12_HUMAN; tctex 6; TCTEX6; TEX6; Transcription associated zinc ribbon protein; Zinc ribbon domain containing 1; Zinc ribbon domain containing protein 1; Zinc ribbon domain-containing protein 1; ZNRD1; ZR14
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-126aa
Target Protein Sequence
MSVMDLANTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
29.9kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase I which synthesizes ribosomal RNA precursors.
Gene References into Functions
  1. Findings suggest a tumor suppressor function for ZNRD1 gene and a tumor contributor function for long noncoding RNAs (IncRNAs) ZNRD1-AS1 in the process of carcinogenesis of lung cancer. PMID: 27166266
  2. ZNRD1 regulatory SNPs may be susceptibility makers for risk of both chronic HBV infection and HCC. PMID: 25110835
  3. This study provides novel evidence that ZNRD1 polymorphism may confer host resistance to HIV-1 acquisition. PMID: 24842830
  4. A miR-508-5p/ZNRD1/ABCB1 regulatory loop has a critical role in MDR in gastric cancer. PMID: 23893241
  5. Variants in ZNRD1 gene predict HIV-1/AIDS disease progression in a Han Chinese population in Taiwan. PMID: 23874430
  6. Nominal associations were found between ZNRD1 rs1150740 and risk of AERD via codominant and dominant genetic inheritance (P=.03; odds ratio, 1.14 [1.14-10.16]). PMID: 22697009
  7. The results of human miRNA array and real-time PCR showed that ZNRD1 could significantly up-regulate the expression of miR-214 and down-regulate the expression of miR-296. PMID: 21080911
  8. siRNA-based functional analysis showed that ZNRD1 down-regulation by siRNA or shRNA impaired HIV-1 replication at the transcription level in both lymphoid and nonlymphoid cells. PMID: 20192730
  9. ZNRD1 gene displays high expression in VCR resistant gastric cancer cells. PMID: 12795835
  10. overexpression of ZNRD1 could promote multidrug-resistant phenotype of gastric cancer cells through upregulation of P-glycoprotein PMID: 14726695
  11. This study clearly demonstrates that ZNRD1 may play an important role in the control of human gastric cancer development by regulating cell proliferation. PMID: 15358150
  12. ZNRD1 may play an important role in the regulation of gastric carcinogenesis and could be used as a new target in treatment of stomach cancer PMID: 15662122
  13. ZNRD1 significantly inhibits the in vitro and in vivo growth of human gastric cancer cell line MKN28 by targeting cell cycle-related genes and reducing tumor angiogenesis. PMID: 17389617
  14. The up-regulation of ZNRD1 significantly inhibited the drug sensitivity of gastric cancer cells over-expressing DARPP-32, indicating that ZNRD1 may be important in the DARPP-32-mediated MDR of gastric cancer PMID: 17492506
  15. DARPP-32 mediates multidrug resistance of gastric cancer through regulation of P-gp and ZNRD1. PMID: 18058465
  16. ZNRD1-expressing cells exhibited enhanced DNA repair capacity and overexpression could upregulate the expression of excision repair cross-complementing 1 (ERCC1) gene PMID: 18564169
  17. ZNRD1 was down-regulated in esophageal cancer tissues compared to adjacent non-neoplastic tissues. PMID: 18594968

Show More

Hide All

Subcellular Location
Nucleus, nucleolus.
Protein Families
Archaeal RpoM/eukaryotic RPA12/RPB9/RPC11 RNA polymerase family
Database Links

HGNC: 13182

OMIM: 607525

KEGG: hsa:30834

STRING: 9606.ENSP00000331111

UniGene: Hs.57813

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*