Recombinant Human DNA mismatch repair protein Msh3 (MSH3), partial

In Stock
Code CSB-EP015029HU
Abbreviation Recombinant Human MSH3 protein, partial
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
Divergent upstream protein;Mismatch repair protein 1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
75-297aa
Target Protein Sequence
LPPHIATEIDRRKKRPLENDGPVKKKVKKVQQKEGGSDLGMSGNSEPKKCLRTRNVSKSLEKLKEFCCDSALPQSRVQTESLQERFAVLPKCTDFDDISLLHAKNAVSSEDSKRQINQKDTTLFDLSQFGSSNTSHENLQKTASKSANKRSKSIYTPLELQYIEMKQQHKDAVLCVECGYKYRFFGEDAEIAARELNIYCHLDHNFMTASIPTHRLFVHVRRL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
32.4 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Component of the post-replicative DNA mismatch repair system (MMR). Heterodimerizes with MSH2 to form MutS beta which binds to DNA mismatches thereby initiating DNA repair. When bound, the MutS beta heterodimer bends the DNA helix and shields approximately 20 base pairs. MutS beta recognizes large insertion-deletion loops (IDL) up to 13 nucleotides long. After mismatch binding, forms a ternary complex with the MutL alpha heterodimer, which is thought to be responsible for directing the downstream MMR events, including strand discrimination, excision, and resynthesis.
Gene References into Functions
  1. The role of MSH3 in 11 Lynch Syndrome patients with truncating MSH6 germline variants and an unexplained MSH2 protein loss.Heterozygous MSH3 defects alone do not seem to induce a Lynch Syndrome phenotype PMID: 28528517
  2. MSH3 was frequently inactivated by promoter methylation and its mRNA and protein expression correlated with the primary tumor stage in nasopharyngeal carcinoma. PMID: 28656302
  3. Msh3-/- cells are severely defective for CTG*CAG repeat expansions but show full activity on contractions. Msh3 overexpression led to high expansion activity and elevated levels of MutSbeta complex, indicating that MutSbeta abundance drives expansions. Expression of 2 Msh3 polymorphic variants at normal levels showed no detectable change in expansions. These polymorphisms primarily affect Msh3 protein stability, not ac... PMID: 28973443
  4. MSH3 is probably a modifier of disease progression in Huntington's disease. PMID: 28642124
  5. data suggest that MSH3 mutations represent an additional recessive subtype of colorectal adenomatous polyposis PMID: 27476653
  6. Three polymorphisms in MSH3 were associated with variation in somatic instability in myotonic dystrophy type 1. PMID: 26994442
  7. Our meta-analysis results demonstrated that MSH3 rs26279 G > A polymorphism is associated with an increased risk of overall cancer, especially for the colorectal cancer and breast cancer. PMID: 26617824
  8. Data show that single nucleotide polymorphisms in MutS homolog 3 (MSH3) had an impact on the chemotherapy response and prognosis of advanced non-small cell lung cancer (NCSLC) patients who were treated with platinum-based chemotherapy. PMID: 25966119
  9. IL6 signaling disrupts the nuclear localization of hMSH3 and DNA repair, leading to elevated microsatellite alterations at selected tetranucleotide repeats in cancer cell lines. PMID: 25461668
  10. Methylation of MSH3 together with exposure to tobacco smoke is involved in esophageal carcinogenesis. PMID: 24934723
  11. MSH3 status can regulate the DNA damage response and extent of apoptosis induced by chemotherapy. PMID: 23724141
  12. Single nucleotide polymorphisms in MSH3 are associated with myelodysplastic syndromes. PMID: 23339595
  13. Oxidative stress, which causes a shift of hMSH3's subcellular location, may contribute to an hMSH3 loss-of-function phenotype by sequestering it to the cytosol PMID: 23226332
  14. The binding of HIF-1alpha complexes to hypoxia response element sites is necessary for down-regulation of hMSH3 in both wt-p53 and mut-p53 cells. PMID: 22343000
  15. The high frequency of loss of heterozygosity as well as the aberrant protein expression in some tumors indicates an involvement of MSH3 impairment in colorectal cancer with low-level microsatellite instability. PMID: 22249440
  16. polymorphisms in MSH3 do not contribute to cancer risk in a population of Lynch syndrome patients with colorectal cancer PMID: 21974800
  17. two novel HLA-A0201-restricted cytotoxic T cell epitopes derived from a (-1) frameshift mutation of a coding A(8) tract within the MSH3 gene PMID: 22110587
  18. We hypothesise a model in which variants of the MSH3 gene behave as low-risk alleles that contribute to the risk of colon cancer in Lynch families, mostly with other low-risk alleles of MMR genes. PMID: 21128252
  19. Stress treatment of mouse cells with ethanol or hydrogen peroxide caused the re-distribution of MSH3 into nuclear bodies containing the proliferating cell nuclear antigen (PCNA), a known binding partner of MutSbeta. PMID: 21344488
  20. Results provide novel evidence that MSH3 deficiency contributes to the cytotoxicity of platinum drugs through deficient DSB repair. PMID: 21285347
  21. Nondysplastic epithelium from hamartomatous polyposis syndrome polyps harbors hMSH3 defects, which may prime neoplastic transformation. PMID: 20845481
  22. No association of tumor necrosis with expression of p53, bcl-2, and mismatch repair protein status was observed in colorectal cancers. PMID: 20869096
  23. Loss of hMSH3 corresponds with multiple tetranucleotide frameshifts. The association between EMAST and ulcerated tumors might result from increased inflammation. PMID: 20708618
  24. Endoscopic biopsy provides equal accuracy and easier interpretation of MMRP expression immunostaining compared to surgical resection specimens. PMID: 20632816
  25. This is the first report suggesting that genetic and epigenetic alterations in the human MSH3 gene might play a significant role in the progression of bladder tumors. PMID: 15541380
  26. Plays a key role in the formation of CTG repeat expansions over successive generations in DM1 transgenic mice. PMID: 16552576
  27. Polymorphisms in the mismatch repair gene, MSH3 is associated with colorectal cancer PMID: 17205513
  28. Alterations in TGF-betaRII, BAX, IGFIIR, caspase-5, hMSH3 and hMSH6 genes of microsatellite instability are rare in urinary bladder carcinoma and they are not associated with microsatellite instability or the presence of p53 mutations. PMID: 17676485
  29. Mutations at the mononucleotide repeats within the hMSH3 gene occurred in certain basal cell carcinomas, not always in association with microsatellite instability . PMID: 17950544
  30. Mismatch repair gene MSH3 polymorphism is associated with the risk of sporadic prostate cancer PMID: 18355840
  31. Genetic instability caused by loss of MutS homologue 3 in human colorectal cancer. PMID: 18922920

Show More

Hide All

Involvement in disease
Endometrial cancer (ENDMC); Familial adenomatous polyposis 4 (FAP4)
Protein Families
DNA mismatch repair MutS family, MSH3 subfamily
Database Links

HGNC: 7326

OMIM: 600887

KEGG: hsa:4437

STRING: 9606.ENSP00000265081

UniGene: Hs.280987

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*