Recombinant Human Deleted in azoospermia-like (DAZL), partial

In Stock
Code CSB-EP006514HU1a2
Abbreviation Recombinant Human DAZL protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Developmental Biology
Alternative Names
DAZ homolog;DAZ-like autosomal;Deleted in azoospermia-like 1;SPGY-like-autosomal
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
130-250aa
Target Protein Sequence
VFNHPPPPQFQNVWTNPNTETYMQPTTTMNPITQYVQAYPTYPNSPVQVITGYQLPVYNYQMPPQWPVGEQRSYVVPPAYSAVNYHCNEVDPGAEVVPNECSVHEATPPSGNGPQKKSVDR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
31.8
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
RNA-binding protein, which is essential for gametogenesis in both males and females. Plays a central role during spermatogenesis. Acts by binding to the 3'-UTR of mRNA, specifically recognizing GUU triplets, and thereby regulating the translation of key transcripts.
Gene References into Functions
  1. computational analysis of free energy change due to this point mutation using GROMOS96 indicated decreased stability of the DAZL protein. The N109T variant in an infertile male population may provide a genetic marker for mutational analysis of DAZL PMID: 28388287
  2. Data suggest that DAZL may be one such factor in human female fertility PMID: 26989066
  3. Through the translational regulation of novel RNA targets SMC1B and TEX11, DAZL may have a key role in regulating chromosome cohesion and DNA recombination; two processes fundamental in determining oocyte quality and whose establishment in foetal life may support lifelong fertility. PMID: 28364521
  4. hypermethylation of DAZL and BOULE promoters in human sperm is associated with human infertility PMID: 27358391
  5. data can be used to further elucidate the role of NANOS3 and DAZL in germ cell development both in vitro and in vivo PMID: 27768780
  6. DAZL was not expressed either in normal cultures or lesions from cervixes with papillomavirus infections and cervical intraepithelial neoplasia. PMID: 25491317
  7. analysis demonstrated that SNP260 of DAZL did not contribute to oligo/azoospermia while SNP386 was correlated to male infertility PMID: 25994644
  8. Neither the A260G nor the A386G polymorphism of DAZL appeared to be involved in male infertility. PMID: 25323654
  9. analysis of T12A and T54A polymorphisms role in the development of male infertility (Meta-Analysis) PMID: 24717865
  10. demonstrate that Boll is also transiently expressed during oogenesis in the fetal mouse ovary, but is simultaneously co-expressed within the same germ cells as Dazl PMID: 24086306
  11. Abnormal DNA methylation of the DAZL promoter might represent an epigenetic marker of male infertility. PMID: 24015185
  12. Amniotic fluid-derived stem cells (AFSc) seem to express Nodal, Nanog and DAZL and it speculated that the regulation of self-renewal in AFSc could be similar as in human embryonic stem cells. PMID: 24459810
  13. The A260G and A386G polymorphisms of the DAZL gene are not correlated with astheno-teratozoospermia-induced male infertility in the Han Chinese population. PMID: 23678708
  14. study identified the core promoter of the DAZL gene; also provided preliminary evidence for the role of a novel SNP of the DAZL gene promoter in spermatogenic failure PMID: 22752612
  15. overexpression of VASA and or DAZL, in both embryonic and induced pluripotent stem cells promoted differentiation into primordial germ cells, and maturation and progression through meiosis was enhanced. PMID: 22162380
  16. results showed no significant differences in the frequency of DAZL AG (P = 0.58) and MTHFR CT (P = 0.44) between oligozoospermic infertile men and controls PMID: 22329245
  17. These results suggest that incorrect epigenetic marks in germline gene DAZL may be correlated with male gametogenic defects. PMID: 20685756
  18. 386A-->G was significantly correlated with sperm count (P<0.0001) and motility (P<0.005) and 584+28c-->t was marginally correlated with sperm morphology. PMID: 20462796
  19. expression of spermatogenic phenotypes of partial AZFc deletions is independent of the variations in DAZL and BOULE in the Han population PMID: 19342699
  20. Dazl contributes to the differentiation of embryonic stem cells into germ cells. PMID: 20008336
  21. Results suggest that DAZL-expressing (DE)cells, which possess some pluripotent/multipotent characteristics of ES cells express OCT-4 and SOX-2 genes, can be easily isolated from blood. PMID: 19327014
  22. role of the autosomal candidate gene DAZLA (Deleted in AZoospermia Like Autosome) in male subfertility PMID: 11499325
  23. The DAZL transcript and protein are present in human spermatozoa. PMID: 11872225
  24. The distinct expression pattern of DAZL protein in the corpus luteum may play an important role in the regulation of luteal function. PMID: 12029071
  25. These findings confirm that DAZL and DAZ can only substitute for early functions of the murine homologue resulting in the establishment of the germ cell population and partial progression into meiosis PMID: 12200456
  26. findings provide strong evidence for the role of the autosomal DAZL gene in human spermatogenesis PMID: 12414900
  27. Data suggest that the T54A polymorphism of deleted-in-azoospermia-like (DAZL) protein might play a role in infertility only in Taiwanese or Asiatic individuals. PMID: 15220464
  28. In a Caucasian population, the DAZL SNP (single nucleotide polymorphism) 386 is completely absent and SNP 260 is not associated with spermatogenic failure and therefore does not represent a molecular marker for genetic diagnosis of male infertility. PMID: 15520024
  29. PUM2 and DAZL, are capable of binding the same mRNA sequences in the 3'UTR of human SDAD1 mRNA. PMID: 15607425
  30. DAZL transcripts are present in the last stages of oocyte maturation, in embryoic cell stems, and throughout the preimplantation development. PMID: 15879466
  31. DAZL activates translationally silent mRNAs during germ cell development through the direct recruitment of polyA-binding proteins. PMID: 16001084
  32. The Thr54-->Ala polymorphism in exon 3 of DAZL has no major role in Japanese males with azoospermia or oligozoospermia. PMID: 16123080
  33. SNPs in the DAZL gene may act jointly to affect common reproductive characteristics in the human population. PMID: 16328470
  34. study demonstrates the absence of the A386G (T54A) mutation in Indian subcontinent and two mutations A260G (T12A) and A437G (I71V) are polymorpic... these mutations in the DAZL gene are not associated with male infertility in Indian subcontinent PMID: 16573709
  35. Novel missense mutations of DAZL may be associated with age at menopause and/or sperm count and warrant further biochemical and genetic investigation. PMID: 16884537
  36. Our results suggest that human amniotic fluid represents a new source for the isolation of human DAZL-, C-kit-, SSEA-4-, and Oct-4-positive stem cells without raising the ethical issues associated with human embryonic research. PMID: 18023443
  37. In ovarian extracts a marked increase in expression of DAZL mRNA and protein occurred in the 2nd trimester. PMID: 18088417
  38. Follicle-stimulating hormone receptor and DAZL gene polymorphisms do not affect the age of menopause. PMID: 18178196

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus.
Protein Families
RRM DAZ family
Tissue Specificity
Testis specific.
Database Links

HGNC: 2685

OMIM: 601486

KEGG: hsa:1618

STRING: 9606.ENSP00000250863

UniGene: Hs.131179

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*