Name: Recombinant Human Deoxyribonuclease gamma(DNASE1L3)
Brand: CUSABIO
SKU: CSB-BP621686HUb1

Product Details

Purity	Greater than 85% as determined by SDS-PAGE.
Target Names	DNASE1L3
Uniprot No.	Q13609
Research Area	Cancer
Alternative Names	Deoxyribonuclease gamma; Deoxyribonuclease I like 3; Deoxyribonuclease I like III; Deoxyribonuclease I-like 3; DHP 2; DHP2; DNAS1L3; DNase gamma; DNase I homolog protein 2; DNase I homolog protein DHP2; DNase I like 3; DNase I-like 3; DNASE1L3; DNSL3_HUMAN; Liver and spleen DNase; LS DNase; LS-DNase; LSD; SLEB 16; SLEB16
Species	Homo sapiens (Human)
Source	Baculovirus
Expression Region	21-305aa
Target Protein Sequence	MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight	37.2 kDa
Protein Length	Full Length
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form	Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	3-7 business days
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA	Please contact us to get it.

Target Background

Function	Has DNA hydrolytic activity. Is capable of both single- and double-stranded DNA cleavage, producing DNA fragments with 3'-OH ends. Can cleave chromatin to nucleosomal units and cleaves nucleosomal and liposome-coated DNA. Acts in internucleosomal DNA fragmentation (INDF) during apoptosis and necrosis. The role in apoptosis includes myogenic and neuronal differentiation, and BCR-mediated clonal deletion of self-reactive B cells. Is active on chromatin in apoptotic cell-derived membrane-coated microparticles and thus suppresses anti-DNA autoimmunity. Together with DNASE1, plays a key role in degrading neutrophil extracellular traps (NETs). NETs are mainly composed of DNA fibers and are released by neutrophils to bind pathogens during inflammation. Degradation of intravascular NETs by DNASE1 and DNASE1L3 is required to prevent formation of clots that obstruct blood vessels and cause organ damage following inflammation.
Gene References into Functions	The authors found a significant reduction in serum DNase1l3 level in dermatomyositis/polymyositis and systemic lupus erythematosus, which may associate with clinic features and disease activity. PMID: 28039554 Data indicate a likely functional variant influencing scleroderma susceptibility at deoxyribonuclease I-like 3 protein DNASE1L3 missense polymorphism rs35677470. PMID: 25332064 Single nucleotide polymorphisms in the DNASE1L3 is associated with autoimmune diseases. PMID: 24206041 DNASE1L3 mutations occur in hypocomplementemic urticarial vasculitis syndrome. PMID: 23666765 We identified a rare autosomal recessive form of systemic lupus erythematosus, in which autozygome analysis revealed a null mutation in the DNASE1L3 gene PMID: 22019780 investigates the distribution of DNASE1L3 gene SNPs in exons of the gene in eight Asian, three African, and three Caucasian populations worldwide using newly devised genotyping methods. PMID: 21692081 The Poly(ADP-ribose) polymerase-1-regulated endonuclease DNAS1L3 is required for etoposide-induced internucleosomal DNA fragmentation and increases etoposide cytotoxicity in transfected osteosarcoma cells. PMID: 12154052 Identification of two functional nuclear localization signals in DNase gamma that have a role in apoptotic DNA fragmentation. PMID: 12943533 DNase gamma is involved in the generation of resected double-strand DNA breaks associated with somatic hypermutation PMID: 15629432 DNAS1L3 plays an active role in lymphoma cell sensitization to VP-16 and its deficiency may constitute a novel mechanism of drug resistance in these cells PMID: 16427601 A Caucasian-specific allele in SNP R206C produces an inactive form of DNase Il3. PMID: 19559017 Results distinguish DNase gamma-dependent and CAD/DFF40-dependent DNA fragmentations, and show that even if DNA fragmentation is initiated by CAD/DFF40, DNase gamma is required for the more complete digestion of the genomic DNA in dying cells. PMID: 19574717 Show More Hide All
Involvement in disease	Systemic lupus erythematosus 16 (SLEB16)
Subcellular Location	Nucleus. Endoplasmic reticulum. Secreted.
Protein Families	DNase I family
Tissue Specificity	Liver and spleen.
Database Links	HGNC: 2959 OMIM: 602244 KEGG: hsa:1776 STRING: 9606.ENSP00000316193 UniGene: Hs.476453

CloseMessage

Product >> Product Name：
Product >> Code：
Product >> Size：
Name： *
Email： *
Phone：
We recommend you to leave your phone number because occasionally our emails get flagged by spam filters. We would not disclose any of your private information to any third party.
Question/Comment： *
Your Region： *
Country State：
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
Check Code：

Code	CSB-BP621686HUb1
Size	$2112
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Deoxyribonuclease gamma(DNASE1L3)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

CloseMessage

×CloseMessage