Recombinant Human Dermcidin (DCD)

In Stock
Code CSB-YP006537HU
Abbreviation Recombinant Human DCD protein
MSDS
Size $250
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP006537HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) DCD.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP006537HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) DCD.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
DCD
Uniprot No.
Research Area
Signal Transduction
Alternative Names
AIDD ; DCD 1; dcd; DCD-1; DCD_HUMAN; Dermcidin; DSEP; HCAP; PIF; Preproteolysin
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
20-110aa
Target Protein Sequence
YDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
11.3kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
DCD-1 displays antimicrobial activity thereby limiting skin infection by potential pathogens in the first few hours after bacterial colonization. Highly effective against E.coli, E.faecalis, S.aureus and C.albicans. Optimal pH and salt concentration resemble the conditions in sweat. Also exhibits proteolytic activity, cleaving on the C-terminal side of Arg and, to a lesser extent, Lys residues.; Survival-promoting peptide promotes survival of neurons and displays phosphatase activity. It may bind IgG.
Gene References into Functions
  1. the present study suggests that dermcidin is a novel binding protein of lncRNA STCAT3, which serves an important role in the progress and clinical outcome of gastric cancer PMID: 30226544
  2. The results of this study suggest that these biomarker DCD can serve as a potential non-invasive early diagnosis platform reflecting PiB-PET imaging for Mild Cognitive Impairment and Alzheimer's Disease. PMID: 27392853
  3. this study shows that PIF regulates systemic immunity and targets protective regulatory and cytoskeleton proteins PMID: 26944449
  4. This is the first report of the presence of DCD in nasal mucosa and demonstration of DCD in clinical samples of human nasal secretions at clinically relevant concentrations, which may represent a novel arm of sinonasal airway innate defense. PMID: 27650261
  5. Identification of dermcidin in human sebaceous gland cells supports the concept that sebocytes play an important role in the innate immunity of the skin through the expression of antimicrobial peptides and specific lipids. PMID: 26718508
  6. Reduced DCD concentration in sweat in patients with inflammatory acne may permit proliferation of P. acnes in pilosebaceous units, resulting in progression of inflammatory acne. PMID: 25673161
  7. These findings imply that DCD promotes breast tumorigenesis via modulation of ERBB signaling pathways PMID: 25879571
  8. Dermcidin binds platelets and may inhibit the therapeutic action of aspirin following acute myocardial infarction. PMID: 25055737
  9. Data indicate that Y-P30/dermcidin expressed in placentas of first trimester pregnancies. PMID: 24969620
  10. Increased Dermcidin was also detected with immunoblotting. PMID: 24562771
  11. Crystal structure and functional mechanism of a human antimicrobial membrane channel PMID: 23426625
  12. major binding partners of LEKTI were found to be the antimicrobial peptide dermcidin and the serine protease cathepsin G and no kallikreins. PMID: 22588119
  13. Structure-activity analysis of the dermcidin-derived peptide DCD-1L, an anionic antimicrobial peptide present in human sweat. PMID: 22262861
  14. revealed that Nck1 SH2 domain binds to the phosphotyrosine residue at position 20 (Y20) of the DCD PMID: 21397687
  15. dermcidin was a novel platelet aggregating agent, and potentiated the ADP induced thrombosis in the animal model as well as acutely inhibited glucose induced insulin synthesis. PMID: 20809104
  16. There was a significant correlation between weight loss and survival in the PIF-positive non-small-cell lung cancer patients. PMID: 20837461
  17. Data show that dermcidin adopts a flexible amphipathic alpha-helical structure with a helix-hinge-helix motif, which is a common molecular fold among antimicrobial peptides. PMID: 20510021
  18. identified as antibiotic peptide secreted by sweat glands PMID: 11694882
  19. Our results confirmed previous findings indicating that dermcidin-1L could have promising therapeutic potentials and shed new light on the structure-function relationship of dermcidin-1L. PMID: 15670776
  20. Reduced expression of dermcidin in sweat of patients with atopic dermatitis may contribute to the high susceptibility of these patients to skin infections and altered skin colonization with Staphylococcus aureus. PMID: 15944307
  21. NF-kappaB and STAT3 are activated by proteolysis inducing factor in human Kupffer cells and monocytes PMID: 16142329
  22. Functional analysis indicated that proteolytic processing of DCD-1L by Cathepsin D in human sweat modulates the innate immune defense of human skin. PMID: 16354654
  23. Dermcidin may function as an oncogene in hepatic as well as breast cells; Glycosylation is not required, but the importance of asparagine residues suggests a role for the proteolysis-inducing factor core peptide domain. PMID: 16685272
  24. This work suggests that DCD might participate in the regulation of placental function by means of modulating the proteolytic cascades on the trophoblastic cell surface. PMID: 17448443
  25. Dermcidin is a proliferation and survival factor in prostate cancer cells subjected to stressors found in the prostate cancer microenvironment. PMID: 17626247
  26. These data suggest that the disorder and order transition may be relevant for some biological functions of PIF/DCD. PMID: 18058718
  27. There is a growing body of evidence illustrating dermcidin as an oncogene and its Y-P30 subunite as a survival factor (Review) PMID: 18403914
  28. Expression of dermcidin in human primary tumours appears highly variable and is not induced substantially by hypoxia/oxidative stress in cell line model systems PMID: 18594538
  29. pleiotrophin (PTN) and syndecan-2 and -3 as direct binding partners of Y-P30. PMID: 18599487
  30. IRAK-4, which is essential for virtually all TLR signalling, was suppressed, whereas the precursor for the antibiotic peptide Dermcidin was up-regulated in HIV-infected cells. PMID: 19703016

Show More

Hide All

Subcellular Location
Secreted.
Tissue Specificity
Specifically and constitutively expressed in eccrine sweat gland cells. Secreted into the sweat at a concentration of 1-10 micrograms/ml.
Database Links

HGNC: 14669

OMIM: 606634

KEGG: hsa:117159

UniGene: Hs.350570

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*