Recombinant Human Desmoglein-3 (DSG3), partial

In Stock
Code CSB-EP007205HU(F)
Abbreviation Recombinant Human DSG3 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
DSG3
Uniprot No.
Research Area
Cell Adhesion
Alternative Names
130 kD pemphigus vulgaris antigen; 130 kDa pemphigus vulgaris antigen; Balding; Cadherin family member 6; CDHF 6; CDHF6; Desmoglein 3; Desmoglein 3 precursor; Desmoglein-3; Desmoglein3; DKFZp686P23184; DSG 3; DSG3; DSG3_HUMAN; Pemphigus vulgaris antigen; PVA
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
70-499aa
Target Protein Sequence
IAKITSDYQATQKITYRISGVGIDQPPFGIFVVDKNTGDINITAIVDREETPSFLITCRALNAQGLDVEKPLILTVKILDINDNPPVFSQQIFMGEIEENSASNSLVMILNATDADEPNHLNSKIAFKIVSQEPAGTPMFLLSRNTGEVRTLTNSLDREQASSYRLVVSGADKDGEGLSTQCECNIKVKDVNDNFPMFRDSQYSARIEENILSSELLRFQVTDLDEEYTDNWLAVYFFTSGNEGNWFEIQTDPRTNEGILKVVKALDYEQLQSVKLSIAVKNKAEFHQSVISRYRVQSTPVTIQVINVREGIAFRPASKTFTVQKGISSKKLVDYILGTYQAIDEDTNKAASNVKYVMGRNDGGYLMIDSKTAEIKFVKNMNRDSTFIVNKTITAEVLAIDEYTGKTSTGTVYVRVPDFNDNCPTAVLEK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
64.0kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Desmoglein-3 (DSG3) is expressed in E.coli and covers the 70-499 amino acid region of the protein. The protein carries an N-terminal 6xHis-SUMO tag to help with purification, reaching a purity level greater than 90% as confirmed by SDS-PAGE analysis. This recombinant protein is designed for research use only and provides reliable quality for experimental work, though no specific endotoxin level is specified.

Desmoglein-3 appears to be a key component of desmosomes—specialized structures that help cells stick together in epithelial tissues. The protein seems particularly important for maintaining tissue integrity and cohesion, especially in skin and mucous membranes. Research into DSG3's function and interactions may prove valuable for studies on cell adhesion, tissue development, and related diseases.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Human DSG3 is a transmembrane cadherin-like protein that requires complex folding, including disulfide bond formation, calcium ion binding, and correct dimerization for bioactivity. E. coli, as a prokaryotic expression system, lacks the machinery for eukaryotic-specific post-translational modifications (e.g., glycosylation) and cannot properly fold transmembrane proteins or their extracellular domains. The partial length (aa 70-499) likely corresponds to the extracellular domain but misses the transmembrane and intracellular regions, which are critical for native conformation. The His-SUMO tag may improve solubility but can interfere with folding. Therefore, this protein is highly unlikely to be correctly folded or bioactive, as it probably forms misfolded aggregates or non-functional structures.

Given the high likelihood of misfolding, this recombinant DSG3 protein should not be used for functional studies (e.g., interactions or binding assays) without prior validation of its conformation. First, perform basic biophysical tests (e.g., circular dichroism to check for expected β-sheet structures, and size-exclusion chromatography to monitor oligomerization) to assess folding status. If misfolding is confirmed, limit applications to non-functional uses like antibody production.

This DSG3 fragment can be used as an immunogen for antibody production, as antibodies may recognize linear epitopes even in misfolded proteins. However, antibodies generated might not bind to native, correctly folded DSG3 in physiological contexts (e.g., in tissues or cell surfaces). The high purity reduces cross-reactivity risks, but validation must include testing against full-length, properly folded DSG3 from mammalian cells to ensure specificity. The His-SUMO tag could induce non-specific antibodies, so tag removal or control experiments are advised.

For reliable results, consider switching to a eukaryotic expression system (e.g., mammalian or insect cells) for producing full-length DSG3 with correct folding and activity.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion.
Gene References into Functions
  1. flotillin has a role in desmosomal adhesion and Pemphigus vulgaris-like localisation of desmoglein-3 in human keratinocytes PMID: 27346727
  2. our findings suggest that Dsg3 functions as a key in cell-cell adhesion through at least a mechanism of regulating E-cadherin membrane trafficking PMID: 27254775
  3. Desmoglein 3 Order and Dynamics in Desmosomes PMID: 29212005
  4. Data indicate that all 3 monoclonal antibodies (mAbs) targeted the same extracellular cadherin (EC) domain on desmoglein 3 (Dsg3), caused Dsg3 internalization in primary keratinocytes, and caused suprabasal blisters in skin. PMID: 27304671
  5. DSG3 was a key prognostic factor and predictor for neoadjuvant concurrent chemoradiotherapy response in rectal cancer patients. PMID: 27040321
  6. Treg cells exert a clear down-regulatory effect on the Dsg3-driven T-cell response and, accordingly, the formation of Dsg3-specific IgG antibodies PMID: 26661498
  7. Data identify DSG3 as a negative prognostic biomarker in resected pancreatic ductal adenocarcinoma, as high DSG3 expression is associated with poor overall survival and poor tumour-specific survival. PMID: 26469831
  8. this study directly demonstrates the occurrence of desmoglein 3 molecules outside of desmosomes and reveales that the adhesive properties of these molecules do differ depending on their localization. PMID: 25510735
  9. DSG2 and DSG3 might be potential diagnostic markers for squamous cell carcinoma of the lung and DSG3 could be a potential differentiation marker for lung cancer. PMID: 25468811
  10. alterations of their expression suggest a role of Dsg3 and gamma-catenin (additionally to E-cadherin/beta-catenin) as biomarkers of malignant transformation risk of oral dysplasia and the biological behavior (aggressiveness) of oral cancer, respectively PMID: 23430339
  11. the Dsg3 epitopes targeted by pathogenic mPV IgG are human specific in mice PMID: 25695683
  12. Pemphigus vulgaris is characterized by low IgG reactivities to specific self-antigens along with high IgG reactivity to desmoglein 3. PMID: 24820664
  13. High DSG3 mRNA expression is associated with esophageal squamous cell carcinoma. PMID: 24568510
  14. Pemphigus vulgaris autoimmune globulin induces Src-dependent tyrosine-phosphorylation of PKP3 and its detachment from DSG3. PMID: 24328683
  15. Dsg3 did not associate with rafts in cells lacking desmosomal proteins. PMID: 24498201
  16. this study identifies a novel Dsg3-mediated c-Jun/AP-1 regulatory mechanism and PKC-dependent Ezrin phosphorylation that could be responsible for Dsg3-associated cancer metastasis. PMID: 23752190
  17. DSG3 functions as an oncogene and facilitates cancer growth and invasion in head and neck cancer cells PMID: 23737966
  18. The conformational Dsg3 ELISA index reflected the pathogenicity of anti-Dsg3 antibodies more accurately than the conventional Dsg3 ELISA index in pemphigus vulgaris. PMID: 23602628
  19. MAC387 and desmoglein-3 are reliable diagnostic markers for supporting the morphologic impression of squamous differentiation in urinary bladder carcinoma. PMID: 23806524
  20. All 3 markers were studied independently and were associated with tumor percentage in metastatic lymph nodes. PVA had the strongest correlation, followed by PTHrP and then TACSTD1. PMID: 23625795
  21. provide a proof of principle supporting that ultrasensitive nanostructured assay systems for DSG3 can be exploited to detect micrometastatic HNSCC lesions in lymph nodes, which can improve the diagnosis PMID: 23010602
  22. The cis-adhesive interface on extracellular subdomain EC1 recognized by the pathogenic antibody PVA224 is the primary target of the autoantibodies present in the serum of pemiphigus vulgaris patients. PMID: 22996451
  23. an important novel function for Dsg3 in promoting actin dynamics through regulating Rac1 and Cdc42 activation in epithelial cells. PMID: 22796473
  24. a useful immunohistochemical marker for differentiation of lung squamous cell carcinoma and adenocarcinoma from other subtypes PMID: 22495379
  25. In paraneoplastic pempigus and pemphigus vulgaris, IgG autoantibodies to DSG3 may be found in autoantibody profiling. PMID: 22318391
  26. Report mapping of B cell epitopes on desmoglein 3 in pemphigus vulgaris patients by the use of overlapping peptides. PMID: 22261006
  27. These findings suggest a novel function for Dsg3 in the control of E-cadherin-Src signalling and cell-cell adhesion. PMID: 22294297
  28. These data indicate a contribution of Dsg depletion to pemphigus vulgaris pathogenesis dependent on Ca(2+)-induced differentiation. PMID: 21864491
  29. Silencing desmoglein 3 caused defects in cell-cell adhesion and concomitant reduction in cell proliferation in both HaCaT and MDCK cells. PMID: 21702856
  30. Dsg3, as an up-stream regulator of Src activity, helps regulate adherens junction formation through its interaction with E-cadherin PMID: 21151980
  31. The genetic background of the local population may explain why pemphigus occurs more commonly than bullous pemphigoid in Northwestern Romania compared with the population of Western Europe PMID: 20618495
  32. results argue against the hypothesis that DSG3 coding variants play a role in pemphigus vulgaris susceptibility PMID: 19678820
  33. Data strongly support the view that desmoglein 3 contributes to the regulation of epidermal differentiation. PMID: 12138195
  34. The appearance of DSG3-reactive Th2 cells is constant at different stages of pemphigus vulgaris (PV), while DSG3-reactive Th1 cells are detected at a significantly higher frequency in chronic active PV. PMID: 12496453
  35. In trichilemmal keratinization in follicle, and in cysts in these areas, desmoglein 3 expressed throughout outer root sheath and cyst wall. In areas of epidermal-like keratinization, desmoglein 3 expression was limited mainly to the basal layer. PMID: 12787134
  36. a novel negative marker for epidermal stem cell-containing population of keratinocytes PMID: 12953062
  37. Dsg3(AA145-192)-specific cells preferentially utilize the TCRVbeta13 gene, while Dsg3(AA240-303)- and Dsg3 (AA570-614)-specific cells utilize Vbeta7 and Vbeta17 genes, respectively PMID: 14675184
  38. The five genes, and three of the encoded proteins, were shown differentially expressed between a group of keratoconus patients and a reference group using different techniques PMID: 16015083
  39. Dsg3 endocytosis, keratin filament retraction, and the loss of keratinocyte cell-cell adhesion are coordinated responses to PV IgG PMID: 16377623
  40. autoantibodies against desmoglein 3 (Dsg3) have been detected in sera from patients with fogo selvagem PMID: 16763546
  41. analysis of desmoglein 3 ectodomain in pemphigus vulgaris PMID: 16842599
  42. Overexpression of DSG3 is associated with head and neck cancer PMID: 16878157
  43. Desmoglein 3 status indicated a poor prognosis in lung cancers. PMID: 17084439
  44. The T cellular autoimmune response against immunodominant peptides of Dsg3 in patients with pemphigus vulgaris is monitored with highly specific HLA-DRbeta1*0402 tetramers. PMID: 17113829
  45. These data indicate that Dsg3(dim) populations from primary human adult keratinocytes and long-term established keratinocyte lines possess certain stem/progenitor cell-like properties. PMID: 17255524
  46. Data suggest that although the desmoglein (Dsg)3 depletion is not indicative for adhesive strength, it may indicate pathogenic changes within the cell and it plays a role in skin fragility or susceptibility to blister formation in pemphigus patients. PMID: 17428808
  47. Reduction of Dsg3 might be relevant to blister formation in pemphigus vulgaris. PMID: 17431647
  48. pemphigus vulgaris-IgG-dependent uPA activation is not related to anti-Dsg3 antibody activity PMID: 17532189
  49. Autoantibody from pemphigus vulgaris sera react with non-conformational epitopes of desmoglein 3. PMID: 18095943
  50. results indicate that the membrane proximal region in the IA region of Dsg3 is necessary for complex formation with P120-catenin and to maintain free Dsg3 at the cell surface before it is integrated into desmosomes PMID: 18343367

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cell junction, desmosome.
Tissue Specificity
Epidermis, tongue, tonsil, esophagus and carcinomas.
Database Links

HGNC: 3050

OMIM: 169615

KEGG: hsa:1830

STRING: 9606.ENSP00000257189

UniGene: Hs.1925

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*