Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Signal Transduction
Alternative Names
Dickkopf 2; Dickkopf gene 2 ; Dickkopf homolog 2 ; Dickkopf related protein 2; Dickkopf WNT signaling pathway inhibitor 2; Dickkopf-2; Dickkopf-related protein 2; Dickkopf2; DKK 2; Dkk-2; Dkk2; DKK2_HUMAN; hDkk 2; hDkk-2; hDkk2
Species
Homo sapiens (Human)
Expression Region
34-259aa
Target Protein Sequence
KLNSIKSSLGGETPGQAANRSAGMYQGLAFGGSKKGKNLGQAYPCSSDKECEVGRYCHSPHQGSSACMVCRRKKKRCHRDGMCCPSTRCNNGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHTKMSHIKGHEGDPCLRSSDCIEGFCCARHFWTKICKPVLHQGEVCTKQRKKGSHGLEIFQRCDCAKGLSCKVWKDATYSSKARLHVCQKI
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The expression region of this recombinant Human DKK2 covers amino acids 34-259. This DKK2 protein is theoretically predicted to have a molecular weight of 41 kDa. This DKK2 recombinant protein is manufactured in e.coli. The N-terminal 6xHis-SUMO tag was fused into the coding gene segment of DKK2, making it easier to detect and purify the DKK2 recombinant protein in the later stages of expression and purification.
Human dickkopf-related protein 2 (DKK2) is a member of the Dickkopf family of proteins, which are involved in the regulation of the Wnt signaling pathway. The Wnt signaling pathway plays a critical role in embryonic development, tissue homeostasis, and cell differentiation. DKK2 acts as an antagonist of Wnt signaling by binding to the LRP5/6 co-receptors, preventing their interaction with Wnt ligands. By inhibiting Wnt signaling, DKK2 contributes to the regulation of cell fate decisions and tissue development. Dysregulation of DKK2 has been implicated in various diseases, including cancer, where altered Wnt signaling is often observed. Studying DKK2 provides insights into the intricate regulatory mechanisms of Wnt signaling and its implications in health and disease.
