Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Target Names

DKK4

Uniprot No.

Q9UBT3

Research Area

Immunology

Alternative Names

(Dickkopf-4)(Dkk-4)(hDkk-4)

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

19-224aa

Target Protein Sequence

LVLDFNNIRSSADLHGARKGSQCLSDTDCNTRKFCLQPRDEKPFCATCRGLRRRCQRDAMCCPGTLCVNDVCTTMEDATPILERQLDEQDGTHAEGTTGHPVQENQPKRKPSIKKSQGRKGQEGESCLRTFDCGPGLCCARHFWTKICKPVLLEGQVCSRRGHKDTAQAPEIFQRCDCGPGLLCRSQLTSNRQHARLRVCQKIEKL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

27.2 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Amino acids 19-224 constitute the expression domain of recombinant Human DKK4. The calculated molecular weight for this DKK4 protein is 27.2 kDa. Expression of this DKK4 protein is conducted in e.coli. The DKK4 coding gene included the N-terminal 6xHis tag, which simplifies the detection and purification processes of the recombinant DKK4 protein in following stages of expression and purification.

Dickkopf-related protein 4 (DKK4) is a member of the Dickkopf (DKK) family, known for its role as an antagonist of the Wnt signaling pathway. Wnt signaling plays a crucial role in regulating cell proliferation, differentiation, and development. DKK4 specifically inhibits Wnt/β-catenin signaling by binding to the Wnt co-receptor LRP5/6 and preventing its interaction with Wnt ligands. This interference negatively regulates the canonical Wnt pathway, influencing cellular processes like embryonic development and tissue homeostasis. DKK4 has been implicated in tumorigenesis, where dysregulation of Wnt signaling is often observed.

Target Background

Function

Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease.

Gene References into Functions

Data suggest a critical role of dickkopf 4 (DKK4) in docetaxel resistance of the lung adenocarcinoma A549 (A549/DTX) cells. PMID: 28981599
in NOD/SCID mice supplemented with high glucose, HepG2 xenografted tumors grew rapidly in which elevated levels of beta-catenin, c-Myc and decreased levels of DKK4 were detected. Knockdown of DKK4 by shRNA promotes proliferation of HCC cells in NG, which is suppressed by treating cells exogenously with recombinant DKK4 protein. Our in vitro and in vivo results indicate an important functional role of DKK4 in glucose fa... PMID: 27272409
Our results indicated that DKK4 might be contributed to predicting EOC progression and prognosis. DKK4 could promote the invasion of EOC through JNK activation. PMID: 28666421
We found that TCF7L1 recruits the C-terminal binding protein (CtBP) and histone deacetylase 1 (HDAC1) to the DKK4 promoter to repress DKK4 gene expression. In the absence of TCF7L1, TCF7L2 and beta-catenin occupancy at the DKK4 promoter is stimulated and DKK4 expression is increased. These findings uncover a critical role for TCF7L1 in repressing DKK4 gene expression to promote the oncogenic potential of CRCs. PMID: 28450117
DKK4 expression is significantly upregulated in human masticatory mucosa during wound healing PMID: 28005267
DKK4 may have function on the development and progression of pancreatic cancer. PMID: 26880586
The recurrence of benign tumors of mammary gland occurred predominantly in women-carriers of mutant alleles with polymorphism rs8190924 of gene GSR and AA rs3763511of gene DKK4. PMID: 26419038
DKK4 upregulated by T3/TR antagonizes the Wnt signal pathway to suppress tumor cell progression PMID: 23958302
rs3923086 in AXIN2 and rs3763511 in DKK4 that did not show any association in the overall population were significantly associated with early on-set and estrogen receptor negative breast cancers, respectively. PMID: 23516639
It would appear that deregulation of the WNT pathway by overexpression of DKK4 may further impair WNT signaling and lead to Anorectal malformations. PMID: 23108157
Our findings suggest a potential tumour suppressive role of DKK4 as well as that of an important regulator of HCC. PMID: 22249261
Found the unique expression of the Wnt antagonist DKK4 in SW480APC, but not parental SW480 cell-derived exosomes. Upregulation of DKK4 in SW480APC cells was confirmed by RT-PCR, immunoblotting, and immunogold electron microscopy. PMID: 22740476
The TR/DKK4/Wnt/beta-catenin cascade influences the proliferation and migration of hepatoma cells during the metastasis process and support a tumor suppressor role of the thyroid hormone receptor. PMID: 21994129
TFAP2E hypermethylation is associated with clinical nonresponsiveness to chemotherapy in colorectal cancer. Functional assays confirm that TFAP2E-dependent resistance is mediated through DKK4. PMID: 22216841
Polymorphism of DKK4 was significantly associated with brain volume in Chinese individuals. PMID: 21341386
chromosome 8 mapping by FISH PMID: 11701963
DKK4 may play a role in schizophrenia pathogenesis PMID: 17553464
DICKKOPF-4 is induced by TCF/beta-catenin and upregulated in human colon cancer, promotes tumour cell invasion and angiogenesis. PMID: 18408752
DKK4 is an important negative regulator of colon cancer cell growth. PMID: 19059704
Dickkopf-4 and -2 are significantly upregulated in most colorectal tumors PMID: 19659606

Hide All

Subcellular Location

Secreted.

Protein Families

Dickkopf family

Tissue Specificity

Expressed in cerebellum, T-cells, esophagus and lung.

Database Links

HGNC: 2894

OMIM: 605417

KEGG: hsa:27121

STRING: 9606.ENSP00000220812

UniGene: Hs.159311

Code	CSB-EP883367HU
Abbreviation	Recombinant Human DKK4 protein
MSDS	MSDS Datasheet
Size	$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Dickkopf-related protein 4 (DKK4)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage