Name: Recombinant Human Dihydropyrimidinase-related protein 2 (DPYSL2)
Brand: CUSABIO
SKU: CSB-YP614975HU

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

DPYSL2

Uniprot No.

Q16555

Research Area

Developmental Biology

Alternative Names

Collapsin response mediator protein 2; Collapsin response mediator protein; Collapsin response mediator protein hCRMP 2; CRAM; CRMP 2; CRMP-2; CRMP2; DHPRP 2; DHPRP2; Dihydropyrimidinase 2; Dihydropyrimidinase like 2; Dihydropyrimidinase like 2 long form; Dihydropyrimidinase related protein 2; Dihydropyrimidinase-related protein 2; DPYL 2; DPYL2; DPYL2_HUMAN; DPYSL 2; Dpysl2; DRP-2; DRP2; Musunc 33; Musunc33; N2A3; TOAD 64; TOAD64; ULIP 2 protein; ULIP-2; Ulip2; Unc-33-like phosphoprotein 2

Species

Homo sapiens (Human)

Source

Yeast

Expression Region

1-572aa

Target Protein Sequence

MSYQGKKNIPRITSDRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLIVPGGVKTIEAHSRMVIPGGIDVHTRFQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVDISEWHKGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQRILDLGITGPEGHVLSRPEEVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAFVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTLIPEGTNGTEERMSVIWDKAVVTGKMDENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVAPPGGRANITSLG
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

64.3kDa

Protein Length

Full Length

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer,50% glycerol

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

An entire Dihydropyrimidinase-related protein 2 (DPYSL2) ORF inserted a 6xHis-tag at the N-terminus was expressed in the yeast cells. The generated protein is the recombinant full-length fusion DPYSL2 containing 1-572aa of human DPYSL2. The SDS-PAGE analysis measured its purity up to 90%, and it has a calculated molecular mass of 64.3 kDa. It also underwent validation by the LC-MS/MS analysis. In-stock DPYSL2 proteins are offered now. This recombinant DPYSL2 protein may find uses in the production of anti-DPYSL2 antibodies or in the studies of developmental biology.

DPYSL2, also called CRMP2, is a cytosolic protein belonging to the five-gene family known for its implication in axonal growth cone collapse. DPYSL2 mediates axonal outgrowth in the developing brain by enhancing microtubule assembly, vesicle trafficking, and synaptic physiology. DPYSL2 interacting with other proteins stabilizes microtubules, facilitates neurite outgrowth, and regulates signaling processes in the central nervous system (CNS). The ablation of DPYSL2 may lead to neurodevelopmental disorders including unregulated axon growth and branching, which suggests that DPYSL2 plays a crucial role in the pathogenesis of schizophrenia. Liu-Lin Xiong etc. demonstrated that an increase of DPYSL2 expression promotes neural stem cells (NSCs) differentiates into neurons.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

Regarding the in-stock protein CSB-YP614975HU, could I order this protein without glycerol? Would you guys be willing to dialyze the protein to remove the glycerol? If so, how much would the cost of this service be? Or you cannot perform dialysis on such a small quantity as there will be too much loss?

Thanks for your inquiry. For liquid protein: Glycerol is necessary, we don't recommend to ship the protein in buffer (liquid form) without any glycerol. The glycerol content can be adjusted according to your demand, generally 5%-50% is OK.
Glycerol has a protective effect on protein. First, it can increase the stability of the protein (reducing the polarity of the buffer and preventing hydrophobic aggregation of the protein). Second, it can reduce the freezing point of the system and facilitate the preservation of the protein at low temperatures, especially when the protein is repeatedly frozen and thawed. Protein damage (aggregation or inactivation) can be avoided as much as possible. As for the final concentration of glycerol, in principle, the final concentration of 5%-50% has no problem, it may involve in the preservation of time, high glycerol content is relatively conducive to longer storage. However, the fianl content can be adjusted according to your request,
If you insist not to add any glycerol, we can also meet your demand, but we should disclaim in advance that without addition of glycerol may lead to protein instability, especially the protein itself is unstable.
For lyophilized protein: There isn't any glycerol added before or after the lyophilization.
Therefore we recommend you to choose lyophilized protein if you have strict requirement on the glycerol.
If you can accept the lyophilized protein, we can provide lyophilization service for free, lead time will be extended for 3 working days.
How much protein do you need ? For the current 600ug protein in stock, I'm afraid we can only provide 200ug liquid protein at most after removing the glycerol,
If you need more than 200ug liquid protein without glycerol, we have to prepare a new batch, lead time is 22-32 working days.
The lead time for 600ug lyophilized protein or less is 6-10 working days.

We are interested in ordering CSB-YP614975HU (3mg or 5mg). Since we previously requested the protein to be lyophilized, can you guarantee to provide lyophilized protein for this new potential order? If yes, how will you package this order? (Ex. 3mg or 5mg in 1 vial?)
Thank you.

Thanks for your inquiry.
What's your additional requirement for this new order ? Do you need Aseptic Processing and Endotoxin Removal besides lyophilization ?
If it must be lyophilized form, please be noted that we will add 6% trehalose as protective agent during the lyophilization process.
Regarding the package size, we will preferentially meet your demand for the package size if there is any.
If you don't have any requirement, the final package size will be determined during the manufacturing process.
The expected package size is (3mg)3x1mg vials or (5mg)5x1mg vials.

Target Background

Function

Plays a role in neuronal development and polarity, as well as in axon growth and guidance, neuronal growth cone collapse and cell migration. Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. May play a role in endocytosis.

Gene References into Functions

cross-talk between distinct CRMP2 posttranslational modifications is a key factor in determining NaV1.7 trafficking and localization PMID: 27940916
crystal structure of human tetrameric CRMP-2 PMID: 28044206
increased pCRMP2 may underlie the axonal pathology of Lewy body dementias. PMID: 27609071
These data identify a novel oncogenic mechanism where CDK5 activation induces CRMP2A phosphorylation in the nuclei of tumour cells PMID: 26555036
polymorphisms of the DPYSL2 gene in humans may be associated with the development of schizophrenia. PMID: 25847191
Functional variants in DPYSL2 sequence increase risk of schizophrenia and suggest a link to mTOR signaling PMID: 25416705
Changes for CRMP2, TCP1epsilon, TPM2 and 14-3-3gamma were confirmed in experimental tumors and in a series of 28 human SI-NETs. PMID: 25224486
Reduced CRMP2 expression and elevated expression of nuclear phosphorylated CRMP2 may be associated with breast cancer progression. PMID: 23381229
Levels of total GSK3 were decreased in the Huntington disease-affected frontal cortex and this correlated with decreased phosphorylated CRMP2. PMID: 24634145
High dihydropyrimidinase-related protein 2 expression is associated with lung cancer. PMID: 24518087
genetic variants in DPYSL2 may play a role in susceptibility to alcohol dependence. PMID: 23846846
A specific and reversible intermolecular Cys-504-Cys-504 dithiol-disulfide switch in homotetrameric CRMP2 determines two conformations of the quaternary CRMP2 complex that controls axonal outgrowth and thus neuronal development. PMID: 24133216
CRMP-2-dependent regulation of ROCK II activity is mediated through interaction of the CRMP-2L N terminus with the ROCK II catalytic domain as well as by GSK3-dependent phosphorylation of CRMP-2. PMID: 24036111
a novel regulatory mechanism that utilizes CRMP2 SUMOylation to choreograph NaV1.7 trafficking. PMID: 23836888
a new insight into CRMP-2 as a controller of myosin II-mediated cellular functions through the inhibition of ROCK II in nonneuronal cells PMID: 22431514
No Alzheimer disease-associated differences in CNP and DPYSL2 promoter DNA methylation were observed. PMID: 22954668
Deletion analysis of CRMP-2 identified a 51 amino acid sequence in the C-terminus that is required for targeting to the basal body and primary cilium. This domain contains GSK-3beta phosphorylation sites. PMID: 23185275
High levels of nuclear phosphorylated CRMP-2 is associated with lung cancer. PMID: 23023514
CRMP2 hyperphosphorylation is speci fi c to Alzheimer's disease and is not a common event in all forms of dementia and neurodegeneration, especially other tauopathies. PMID: 21860090
findings suggest a major role of phosphorylated CRMP-2 as a mechanism involved in process retraction induced by reactive oxygen species PMID: 22443207
HTLV-1 has the capacity to influence the CRMP2/PI3K/Akt axis thus to positively control cytoskeleton organization and lymphocyte migration. PMID: 22227566
CRMP2 controls dendritic projection; the phosphorylation of CRMP2 at Ser522 is essential for proper dendritic field organization for axonal guidance and spine development . PMID: 22279220
This review discusses the essential biology of CRMP2 in the context of nascent data implicating CRMP2 perturbations as either a correlate of, or plausible contributor to, diverse neuropathologies. PMID: 21271304
Data support DPYSL2 and the surrounding genomic region as a susceptibility locus for schizophrenia. PMID: 21302347
Data provide the first trafficking regulatory role for Crmp2 in non-neuronal cells and support a model in which Crmp2 is an important endocytic regulatory protein that links MICAL-L1.EHD1-based vesicular transport to dynein motors. PMID: 20801876
DPYSL2 does not have a major function in schizophrenia in Japanese subjects. PMID: 20414250
CRMP2 as a tubulin direct binder may be a GTPase-activating protein (GAP) of tubulin in neurite formation and its GAP activity may be regulated by an intramolecular interaction with an N-terminal inhibitory region. PMID: 19666111
Aberrant expression of dihydropyrimidinase related proteins-2,-3 and -4 in fetal Down syndrome brain. PMID: 11771764
No significant associations were found between five polymorphisms of the DRP-2 gene and Bipolar Disorder, nor were associations detected between either of the polymorphisms and bipolar subtypes I and II. PMID: 12951196
Here we show that glial cell line-derived neurotrophic factor (GDNF) enhances CRMP-2 expression in TGW human neuroblastoma cells via activation of RET receptor tyrosine kinase. PMID: 15207709
significant decrease of crmp-2 protein may represent or underlie impaired neuronal plasticity, neurodegeneration, wiring of the brain in mesial temporal lobe epilepsy PMID: 15672539
CRMP-2 transports the Sra-1/WAVE1 complex to axons in a kinesin-1-dependent manner and thereby regulates axon outgrowth and formation PMID: 16260607
collapsin response mediator protein-2 transcriptional activity is inhibited by all-trans-retinoic acid during SH-SY5Y neuroblastoma cell differentiation PMID: 17229153
These observations implicate hyperphosphorylation of CRMP2 as an early event in the development of AD and suggest that it can be induced by a severe APP over-expression and/or processing defect. PMID: 17683481
results indicate that that CRMP-2 may be a novel colorectal cancer biomarker PMID: 18203259
association of neurofibromin and CRMP-2 is essential for neuronal cell differentiation PMID: 18218617
relative resistance to phosphatases might be a common feature of Cdk5 substrates and could contribute to the hyperphosphorylation of CRMP2 and Tau observed in Alzheimer disease PMID: 18460467
Data suggest that collapsin response mediator protein-2 (CRMP-2) is a novel calmodulin-binding protein and that CaM binding may play an important role in regulating CRMP-2 functions. PMID: 19151921
Given that CRMP-2 is a key regulator of axon elongation, this interference with cytoplasmic dynein function by CRMP-2 might have an important role in axon formation, and neuronal development PMID: 19659462
A significant association was found between a single nucleotide polymorphism of the DRP-2 gene and schizophrenia in a North American sample. PMID: 15858820

Hide All

Subcellular Location

Cytoplasm, cytosol. Cytoplasm, cytoskeleton. Membrane. Note=Tightly but non-covalently associated with membranes.

Protein Families

Metallo-dependent hydrolases superfamily, Hydantoinase/dihydropyrimidinase family

Tissue Specificity

Ubiquitous.

Database Links

HGNC: 3014

OMIM: 602463

KEGG: hsa:1808

STRING: 9606.ENSP00000309539

UniGene: Hs.593187

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address