Recombinant Human DnaJ homolog subfamily B member 1 (DNAJB1)

Code CSB-RP039344h
Abbreviation Recombinant Human DNAJB1 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Neuroscience
Alternative Names
DnaJ (Hsp40) homolog subfmaily B member 1; DNAJ 1; DNAJ B1; DnaJ heat shock protein family (Hsp40) member B1; DnaJ homolog subfamily B member 1; DnaJ protein homolog 1; DNAJ1; DNAJB 1; Dnajb1; DNAJB1 protein; DNJB1_HUMAN; HDJ 1 ; HDJ-1; HDJ1; Heat shock 40 kDa protein 1; Heat shock 40kD protein 1; Heat shock protein 40; Hsp 40; HSP40; HSPF 1; HSPF1; Human DnaJ protein 1; Radial spoke 16 homolog B; RSPH16B; Sis1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-340aa
Target Protein Sequence
MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
65.0kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Interacts with HSP70 and can stimulate its ATPase activity. Stimulates the association between HSC70 and HIP. Negatively regulates heat shock-induced HSF1 transcriptional activity during the attenuation and recovery phase period of the heat shock response. Stimulates ATP hydrolysis and the folding of unfolded proteins mediated by HSPA1A/B (in vitro).
Gene References into Functions
  1. this study shows that DNAJB1/HSP40 suppresses Melanoma Differentiation-Associated Gene 5-Mitochondrial Antiviral Signaling Protein function in conjunction with HSP70 PMID: 29069650
  2. Modeling of the different conformations of PRKACA-DNAJB1 Chimeric Kinase revealed no obvious steric interactions of the J-domain with the rest of the RIIbeta holoenzyme. PMID: 29335433
  3. Data show that DnaJ (Hsp40) homolog, subfamily B, member 1 (DNAJB1) is a transcriptional target of forkhead box protein E3 (FOXE3) in a pathway that is crucial for the development of the anterior segment of the eye. PMID: 27218149
  4. These results indicate that Mixed fibrolamellar hepatocellular carcinoma (mFL-HCC) is similar to pure FL-HCC at the genomic level and the DNAJB1:PRKACA fusion can be used as a diagnostic tool for both pure and mFL-HCC PMID: 27029710
  5. These studies demonstrate an important role for cellular chaperone Hsp40/DnaJB1 in influenza A virus life cycle by assisting nuclear trafficking of viral ribonucleoproteins. PMID: 26750153
  6. DNAJB1-PRKACA was evaluated as a key driver of fibrolamellar carcinoma and as a candidate therapeutic target PMID: 26505878
  7. study provides a new molecular mechanism to regulate EGFR signaling through modulation of MIG6 by DNAJB1 as a negative regulator. PMID: 26239118
  8. Whole exome sequencing followed by immunohistochemistry of fibrolamellar hepatocellular carcinoma cell lines and tumors showed two structural variants resulting in fusion transcripts: DNAJB1-PRKCA and CLPTM1L-GLIS3. PMID: 25122662
  9. In this cohort of fibrolamellar hepatocellular carcinoma, almost 80% contained the DNAJB1-PRKACA fusion transcript. PMID: 25557953
  10. Authors identified DNAJB1 as a negative regulator of PDCD5-mediated apoptosis and found that the apoptosis network of PDCD5 regulates cancer cell death. PMID: 25444898
  11. We also found that, despite an initial report to the contrary, the human homolog of Sis1, Hdj1, is capable of [PSI+] prion propagation in place of Sis1 PMID: 25058638
  12. HSP40 interacts with pyruvate kinase M2 and regulates glycolysis and cell proliferation in tumor cells. PMID: 24658033
  13. Studies with specific phosphoantibodies indicate that MK5 phosphorylates Hsp40/DnaJB1 in vivo at Ser-149 or/and Ser-151 and Ser-171 in the C-terminal domain of Hsp40/DnaJB1. PMID: 24309468
  14. Evidence supporting the presence of the DNAJB1-PRKACA chimeric transcript in 100% of the FL-HCCs examined (15/15) suggests that this genetic alteration contributes to tumor pathogenesis. PMID: 24578576
  15. we discovered a new MDM2 interacting protein, DNAJB1, and provided evidence to support its p53-dependent tumor suppressor function. PMID: 24361594
  16. HSP40 and HSP110 function together in protein homeostasis control. PMID: 24091676
  17. methionine deprivation results in an antioxidant response that includes an increase in the levels of HSPA1A and DNAJB1 mRNA PMID: 23395854
  18. There was a positive correlation between DnaJB1 and severity of pulmonary arterial hypertension in peripheral blood mononuclear cells from patients with limited cutaneous systemic sclerosis. PMID: 23400395
  19. Hsp40 regulates the amount of keratin proteins via ubiquitin-proteasome pathway. PMID: 22075554
  20. Mammalian Hsp110 (Apg-2), Hsp70 (Hsc70 or Hsp70) and Hsp40 (Hdj1) were necessary and sufficient to slowly dissolve large disordered aggregates and recover natively folded protein PMID: 22022600
  21. Cellular localization studies showed that NP and Hsp40 co-localize primarily in the nucleus. During IAV infection in mammalian cells, expression of NP coincided with the dissociation of P58(IPK) from Hsp40 and decrease PKR phosphorylation PMID: 21698289
  22. The antiviral activity of overexpressed DNAJC14 occurs in a time- and dose-dependent manner. PMID: 21249176
  23. The crystal structure of full-length Hdj1 was diffracted to 3.90A resolution. PMID: 21139202
  24. 5-fluorouracil & carboplatin specifically induce expression of Hsp40 in hepatoma cells. siRNA knockdown of Hsp40 diminishes survival of drug-exposed cells. PMID: 19901540
  25. Altered expression of HSPF1 was found in brains and lymphoblastoid cells from patients with bipolar disorder. PMID: 14743183
  26. sequestered in discrete foci in the nucleus of the infected cell in herpes simplex virus type 1 infection PMID: 15194794
  27. It is confirmed an increased expression of HSPF1 in the lymphoblastoid cell lines from patients with bipolar I disorder, bipolar II disorder, and schizophrenia. PMID: 15362566
  28. Hsp40 is crucial for Nef-mediated enhancement of viral gene expression and replication PMID: 16179353
  29. hepatitis B virus X protein is the major target of Hdj1 in the inhibition of hepatitis B virus replication PMID: 16842747
  30. These results demonstrate a role for Hsp40/DnaJB6 in the regulation of HIV-2 PIC nuclear transport. PMID: 18032501
  31. The 2.7A structure reveals that Hdj1 forms a homodimer in the crystal by a crystallographic two-fold axis. PMID: 18211704

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus. Nucleus, nucleolus. Note=Translocates rapidly from the cytoplasm to the nucleus, and especially to the nucleoli, upon heat shock.
Database Links

HGNC: 5270

OMIM: 604572

KEGG: hsa:3337

STRING: 9606.ENSP00000254322

UniGene: Hs.515210

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*