Recombinant Human DnaJ homolog subfamily C member 15 (DNAJC15), partial

Code CSB-YP2284HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP2284HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP2284HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP2284HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP2284HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
DnaJ homolog subfamily C member 15; Cell growth-inhibiting gene 22 protein; Methylation-controlled J protein; MCJ; DNAJC15 DNAJD1 GIG22 HSD18
Species
Homo sapiens (Human)
Expression Region
59-150
Target Protein Sequence
RIWKPLEQVITETAKKISTPSFSSYYKGGFEQKMSRREAGLILGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVAAKINEAKDLLETTTKH
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Negative regulator of the mitochondrial respiratory chain. Prevents mitochondrial hyperpolarization state and restricts mitochondrial generation of ATP. Acts as an import component of the TIM23 translocase complex. Stimulates the ATPase activity of HSPA9.
Gene References into Functions
  1. DNAJC15 as a new target gene responsible for ETV7-mediated Doxorubicin-resistance. PMID: 30025229
  2. Acetaminophen interferes with the formation of mitochondrial respiratory supercomplexes via the mitochondrial negative regulator MCJ. Study also show higher levels of MCJ in livers from patients with acetaminophen-induced liver injury. PMID: 29233977
  3. this study shows that memory CD8+ T cells lacking MCJ provide superior protection against influenza virus infection PMID: 27234056
  4. Both DnaJC15 and DnaJC19 formed two distinct subcomplexes with Magmas at the import channel. PMID: 27330077
  5. These results identify the MCJ gene as a transcriptional target of IFNgamma and provide evidence of the dynamic adaptation of normal tissues to changes in the environment as a way to adapt metabolically to new conditions PMID: 26419808
  6. Changes in the expression levels of IRS1, IRS2, RIPK2, RSPO1, and DNA JC15 genes might contribute to the development of insulin resistance and glucose intolerance in the obese boys. PMID: 26040030
  7. Report functional connection between mitochondrial inner membrane protein translocation machinery-associated J-protein DnaJC15 and regulation of cell death pathways. PMID: 24603329
  8. MCJ functions as J co-chaperone of the human TIM23 pre-protein translocase. PMID: 23263864
  9. loss of expression of MCJ by DNA methylation is associated with drug-resistance in ovarian cancer PMID: 14729589
  10. evidence of MCJ hypermethylation in intracranial primitive neuroectodermal tumours (PNETs) (medulloblastomas, supratentorial PNETs & ependymomas); data indicate epigenetic inactivation of MCJ may play a role in development of pediatric brain tumours PMID: 16049974
  11. MCJ is required in these cells to prevent c-Jun-mediated expression of ABCB1 and maintain drug response. PMID: 17283040
  12. Following transient expression of MDR-1 and MCJ, changes in the sensitivity of Sk-Ov-3 cells to paclitaxel were detected whereas expression of Src, Bcl-2 and Bcl-X(L) decreased the sensitivity of Sk-Ov-3 cells to carboplatin. PMID: 18324624

Show More

Hide All

Involvement in disease
Absent or down-regulated in many advanced cases of ovarian adenocarcinoma, due to hypermethylation and allelic loss. Loss of expression correlates with increased resistance to antineoplastic drugs, such as cisplatin.
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.
Tissue Specificity
Expressed at highest levels in heart, followed by liver and kidney.
Database Links

HGNC: 20325

OMIM: 615339

KEGG: hsa:29103

STRING: 9606.ENSP00000368523

UniGene: Hs.438830

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1