Recombinant Human Double-stranded RNA-specific adenosine deaminase(ADAR),partial

Code CSB-EP001324HUe0
Product Type Recombinant Protein
Size US$1726
Uniprot No. P55265
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence MNPRQGYSLSGYYTHPFQGYEHRQLRYQQPGPGSSPSSFLLKQIEFLKGQLPEAPVIGKQTPSLPPSLPGLRPRFPVLLASSTRGRQVDIRGVPRGVHLRSQGLQRGFQHPSPRGRSLPQRGVDCLSSHFQELSIYQDQEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVL
Research Area Epigenetics and Nuclear Signaling
Source E.coli
Gene Names ADAR
Expression Region 1-176aa
Tag Info N-terminal GST-tagged
Mol. Weight 47.2 kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes the hydrolytic deamination of adenosine to inosine in double-stranded RNA (dsRNA) referred to as A-to-I RNA editing
Involvement in disease Dyschromatosis symmetrica hereditaria (DSH); Aicardi-Goutieres syndrome 6 (AGS6)
Subcellular Location Isoform 1: Cytoplasm, Nucleus, Note=Shuttles between the cytoplasm and nucleus (PubMed:7565688, PubMed:24753571), Nuclear import is mediated by TNPO1 (PubMed:24753571), SUBCELLULAR LOCATION: Isoform 5: Cytoplasm, Nucleus, Nucleus, nucleolus
Tissue Specificity Ubiquitously expressed, highest levels were found in brain and lung (PubMed:7972084). Isoform 5 is expressed at higher levels in astrocytomas as compared to normal brain tissue and expression increases strikingly with the severity of the tumor, being high
Database Links

HGNC: 225

OMIM: 127400

KEGG: hsa:103

STRING: 9606.ENSP00000357459

UniGene: Hs.12341

Related Products

ADAR Antibodies

ADAR Antibodies for Human

ADAR Antibodies for Homo sapiens (Human)

ADAR Proteins

ADAR Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.