Recombinant Human Drebrin (DBN1), partial

Code CSB-YP613692HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP613692HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP613692HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP613692HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP613692HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% (SDS-PAGE)
Target Names
DBN1
Uniprot No.
Alternative Names
D0S117E; DBN 1; DBN1; Developmentally regulated brain protein; Developmentally-regulated brain protein; DKFZp434D064; DREB_HUMAN; Drebrin 1; Drebrin; Drebrin E; Drebrin E2; Drebrin1; DrebrinE
Species
Homo sapiens (Human)
Expression Region
1-135aa
Target Protein Sequence
MAGVSFSGHRLELLAAYEEVIREESAADWALYTYEDGSDDLKLAASGEGGLQELSGHFENQKVMYGFCSVKDSQAALPKYVLINWVGEDVPDARKCACASHVAKVAEFFQGVDVIVNASSVEDIDAGAIGQRLSN
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Actin cytoskeleton-organizing protein that plays a role in the formation of cell projections. Required for actin polymerization at immunological synapses (IS) and for the recruitment of the chemokine receptor CXCR4 to IS. Plays a role in dendritic spine morphogenesis and organization, including the localization of the dopamine receptor DRD1 to the dendritic spines. Involved in memory-related synaptic plasticity in the hippocampus.
Gene References into Functions
  1. Drebrin may regulate activities of epigenetic reader ZMYND8 via its cytoplasmic sequestration. PMID: 28966017
  2. Inhibition of cortactin or dynamin-2 abrogated the increased virus entry observed in DBN1-deficient cells, suggesting that DBN1 suppresses dynamin-mediated endocytosis via interaction with cortactin. PMID: 28416666
  3. Lack of drebrin leads to the dysfunction of cell-cell communication, resulting in aberrant migration of metastatic cancer cells, aberrant synaptic function in dementia, and rupture of endothelial integrity. PMID: 28865011
  4. One candidate pathway coupling actin filaments to microtubules consists of the actin filament-binding protein drebrin and the microtubule-binding +TIP protein EB3. This pathway is regulated proximally by cyclin-dependent kinase 5 phosphorylation of drebrin but the upstream elements in the pathway have yet to be identified. PMID: 28865014
  5. These observations indicate that drebrin loss in dendritic spines occurs at the prodromal stage of Alzheimer's disease (AD), before the density and morphology of dendritic spines change. Quantitation of drebrin may be a possible tool for diagnosing the prodromal stage of AD, before dementia development in AD. PMID: 28865022
  6. Taking into account that connexin-43 (Cx43) (together with Cx30) is heavily expressed in astrocytes and that drebrin supports cell-cell contacts, the understanding of details of how brain cells live and die reveals molecular pathology involved in neurodegeneration, Alzheimer's disease (AD), other cognitive disorders, and aging PMID: 28865023
  7. further studies on drebrin and its binding proteins will be of great importance to elucidate the pathologies of various diseases and may contribute to their medical treatment and diagnostics development. PMID: 28865024
  8. through its interaction with CXCR4 and the actin cytoskeleton, drebrin regulates T cell activation. CD4(+) T cells are one of the main targets for the human immunodeficiency virus (HIV)-1. PMID: 28865025
  9. Our work has shown that the immunosuppressant compound BTP2, which blocks Ca(2+) influx into cells, interacts with the actin-reorganizing protein, drebrin. Here we review the role of drebrin in the regulation of calcium signaling, with a focus on immune cells. PMID: 28865026
  10. Upregulation of drebrin was noted in several types of cancers, e.g., basal cell carcinomas for which it may serve as marker, liver metastases of colon carcinomas, and bladder cancer, suggesting that it is involved in regulating actin dynamics during tumor development, progression, and metastasis. PMID: 28865028
  11. drebrin has to be added to the list of actin-binding proteins regulating actin dynamics of mesangial cell processes and foot processes of podocytes. It will be important to determine its role in hereditary and acquired glomerulopathies. PMID: 28865030
  12. these results contribute to the current understanding of cell-cell junction regulation, introducing a new function of drebrin as a stabilizer of endothelial integrity. PMID: 28865031
  13. Cancer cell motility and invasion are crucial elements in the metastatic cascade and involve dramatic changes in cellular morphology that are associated with dynamic remodelling of the cytoskeleton. Interestingly, it now appears that drebrin could deliver this role during cancer development. PMID: 28865033
  14. Drebrin reduces SMC activation through its interaction with the actin cytoskeleton but independently of its interaction with Homer scaffolds to prevent neointima formation. PMID: 27013612
  15. Exploring the relationship between drebrin and cognitive function may provide insight into the early prevention of cognitive impairment and in the diagnosis and treatment of Alzheimer's disease. PMID: 26123582
  16. Drebrin is critical for progranulin-dependent activation of the Akt and MAPK pathways and modulates motility, invasion and anchorage-independent growth in bladder neoplasms. PMID: 25839164
  17. The study compared the proteome profiles of the human colon adenocarcinoma cell line HCT-116 with its metastatic derivative E1. DBN1 was found to be overexpressed in E1 as compared to HCT-116 cells. PMID: 24610677
  18. In basal cell carcinoma tissues, intense and homogeneous drebrin expression was observed mainly at tumor cell-cell boundaries. In contrast, drebrin was stained only weakly and non-homogeneously in trichoblastoma and trichoepthelioma tissue samples. PMID: 24346822
  19. Rab8a and Drebrin E act as key proteins in the regulation of apical trafficking in intestinal epithelial cells. PMID: 24399445
  20. drebrin has a role in HIV infection by modulating viral entry, mainly through the control of actin cytoskeleton polymerization in response to HIV-1 PMID: 23926103
  21. These findings show that drebrin contains a cryptic F-actin-bundling activity regulated by phosphorylation and provide a mechanistic model for microtubule-F-actin coupling. PMID: 23979715
  22. decreasing the drebrin E levels disrupted the normal subapical F-actin-myosin-IIB-betaII-spectrin network and the apical accumulation of EB3, a microtubule-plus-end-binding protein PMID: 22275434
  23. Drebrin contributes to the maintenance of cell shape, and may play an important role in glioma cell motility. PMID: 23201135
  24. The results of this study showed that Hippocampal drebrin loss in mild cognitive impairment. PMID: 22310934
  25. High expression of cytoskeletal protein drebrin is associated with TEL/AML1pos B-cell precursor acute lymphoblastic leukemia PMID: 21497902
  26. Data show that DBN1, SETMAR and HIG2 are direct transcriptional targets of the SOX11 protein. PMID: 21124928
  27. The downregulation of Drebrin in Alzheimer's Disease and Down Syndrome and conversely its upregulation in various carcinomas indicate that Drebrin is an important component of the pathogenesis of multiple diseases. PMID: 20183806
  28. We found decreased levels of drebrin in frontal and temporal cortex from patients with DS and AD. Reduced drebrin could cause loss of spine plasticity in DS and may be a marker for neurodegenerative disorders. PMID: 12009525
  29. These data confirm the role of drebrin E2 in the formation of branching processes and further indicate that during cell migration, the protein contributes to retraction of the cell body and the tail but not to lamellipodia formation. PMID: 16780834
  30. the down-regulation of drebrin mRNA expression plays an important role in Alzheimer's disease and is closely related to the progression of the disease PMID: 18338803
  31. Drebrin targets EB3 to coordinate F-actin-microtubule interactions that underlie neuritogenesis. PMID: 18806788

Show More

Hide All

Subcellular Location
Cytoplasm. Cell projection, dendrite. Cytoplasm, cell cortex. Cell junction. Cell projection, growth cone.
Tissue Specificity
Expressed in the brain, with expression in the molecular layer of the dentate gyrus, stratum pyramidale, and stratum radiatum of the hippocampus (at protein level). Also expressed in the terminal varicosities distributed along dendritic trees of pyramidal
Database Links

HGNC: 2695

OMIM: 126660

KEGG: hsa:1627

STRING: 9606.ENSP00000292385

UniGene: Hs.130316

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1