Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
DCNT22; DCTN 22; DCTN22; Dctn3; DCTN3_HUMAN; dynactin 3 (p22); dynactin 3; dynactin 3 isoform 1; Dynactin complex subunit 22 kDa subunit; dynactin light chain; Dynactin subunit 3; p22
Species
Homo sapiens (Human)
Expression Region
2-176aa
Target Protein Sequence
AGLTDLQRLQARVEELERWVYGPGGARGSRKVADGLVKVQVALGNISSKRERVKILYKKIEDLIKYLDPEYIDRIAIPDASKLQFILAEEQFILSQVALLEQVNALVPMLDSAHIKAVPEHAARLQRLAQIHIQQQAPWGVGVRDEAGSLVEDVGFAQFLSVLHFGPTGPVCGNH
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein of Isoform 2
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The Human DCTN3 protein's gene (2-176aa) is inserted into a plasmid vector, forming recombinant plasmid, which is introduced into e.coli cells. e.coli cells surviving in the presence of a specific antibiotic are selected and then cultured under conditions promoting the expression of the gene of interest. The protein features a N-terminal 6xHis-SUMO tag fusion. After expression, the recombinant Human DCTN3 protein is isolated and purified from the cell lysate through affinity purification. Denaturing SDS-PAGE is utilized to resolve the resulting recombinant protein, revealing a purity exceeding 90%.
