Recombinant Human Dynactin subunit 3 (DCTN3)

In Stock
Code CSB-EP006566HU
Abbreviation Recombinant Human DCTN3 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
DCTN3
Uniprot No.
Research Area
Cell Cycle
Alternative Names
DCNT22; DCTN 22; DCTN22; Dctn3; DCTN3_HUMAN; dynactin 3 (p22); dynactin 3; dynactin 3 isoform 1; Dynactin complex subunit 22 kDa subunit; dynactin light chain; Dynactin subunit 3; p22
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-176aa
Target Protein Sequence
AGLTDLQRLQARVEELERWVYGPGGARGSRKVADGLVKVQVALGNISSKRERVKILYKKIEDLIKYLDPEYIDRIAIPDASKLQFILAEEQFILSQVALLEQVNALVPMLDSAHIKAVPEHAARLQRLAQIHIQQQAPWGVGVRDEAGSLVEDVGFAQFLSVLHFGPTGPVCGNH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
35.3kDa
Protein Length
Full Length of Mature Protein of Isoform 2
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The Human DCTN3 protein's gene (2-176aa) is inserted into a plasmid vector, forming recombinant plasmid, which is introduced into e.coli cells. e.coli cells surviving in the presence of a specific antibiotic are selected and then cultured under conditions promoting the expression of the gene of interest. The protein features a N-terminal 6xHis-SUMO tag fusion. After expression, the recombinant Human DCTN3 protein is isolated and purified from the cell lysate through affinity purification. Denaturing SDS-PAGE is utilized to resolve the resulting recombinant protein, revealing a purity exceeding 90%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Together with dynein may be involved in spindle assembly and cytokinesis.
Gene References into Functions
  1. Study found that in peripheral blood mononuclear cells the median expression of KIFC3, KIF1B, and KIF5C was much lower than the expression of dynactin subunits DCTN1 and DCTN3, in both sporadic amyotrophic lateral sclerosis and healthy cases PMID: 26954557
Subcellular Location
Cytoplasm. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Chromosome, centromere, kinetochore. Cytoplasm, cytoskeleton, spindle. Cleavage furrow. Midbody. Note=Localizes to punctate cytoplasmic structures and to the centrosome during interphase, and to kinetochores and to spindle poles throughout mitosis. Colocalizes with dynein to the cleavage furrow and to midbody of dividing cells.
Protein Families
Dynactin subunit 3 family
Tissue Specificity
Ubiquitously expressed. Highly expressed in muscle and pancreas and detected at lower levels in brain.
Database Links

HGNC: 2713

OMIM: 607387

KEGG: hsa:11258

STRING: 9606.ENSP00000259632

UniGene: Hs.511768

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*