Thanks for your inquiry.
Recombinant Human E3 ubiquitin-protein ligase pellino homolog 1(PELI1)
CSB-YP856932HU >> Yeast
CSB-EP856932HU >> E.coli
CSB-BP856932HU >> Baculovirus
CSB-MP856932HU >> Mammalian cell
Expression Region: 1-418aa; Full length.
Tag information:EP, YP, BP, MP: Tag type will be determined during the manufacturing process.
The expected tag for each expression system is list as follows:
YP: N-terminal 6xHis-tagged; EP, BP, MP: N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Target Protein Sequence:
MFSPDQENHPSKAPVKYGELIVLGYNGSLPNGDRGRRKSRFALFKRPKANGVKPSTVHIACTPQAAKAISNKDQHSISYTLSRAQTVVVEYTHDSNTDMFQIGRSTESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACRIICERNPPFTARIYAAGFDSSKNIFLGEKAAKWKTSDGQMDGLTTNGVLVMHPRNGFTEDSKPGIWREISVCGNVFSLRETRSAQQRGKMVEIETNQLQDGSLIDLCGATLLWRTAEGLSHTPTVKHLEALRQEINAARPQCPVGFNTLAFPSMKRKDVVDEKQPWVYLNCGHVHGYHNWGNKEERDGKDRECPMCRSVGPYVPLWLGCEAGFYVDAGPPTHAFSPCGHVCSEKTTAYWSQIPLPHGTHTFHAACPFCAHQLAGEQGYIRLIFQGPLD
The default buffer is Tris-based buffer, PH=8.0, 50% glycerol.
If you have some special requirement for the buffer, pls let us know in advance.
The 50% glycerol is calculated by volume, 50% refers to the final concentration of glycerol, of course, you can reduce the final concentration of glycerol if you need,
such as the final concentration of 10% glycerol, or if you don't want glycerol, we can also provide lyophilized powder (we will add 6% trehalose during the lyophilization),
the lead time will be extended for 3 working days for lyophilization.
The quotations for 0.1mg and 0.5mg Baculovirus and lead time are provided upon you request.
The concentration of BP protein is generally 0.1-0.5mg/ml after adding glycerol, for example, if the concentration is 0.5mg/ml and order quantity is 100ug, then the final volume would be 200ul,
if the order quantity is 500ug, then the final volume would be 1ml. If you have some requirements for the shipping format or package size, pls let us know in advance.