Home
Protein
Recombinant Proteins
Recombinant Human Fibrinogen-like protein 1 (FGL1)

Recombinant Human Fibrinogen-like protein 1 (FGL1)

^{In Stock}

Code	CSB-MP008653HU
Abbreviation	Recombinant Human FGL1 protein
MSDS	MSDS Datasheet
Size	$660
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

FGL1

Uniprot No.

Q08830

Research Area

Cardiovascular?

Alternative Names

FGL 1; Fgl1; FGL1_HUMAN; Fibrinogen like 1; Fibrinogen like protein 1; Fibrinogen related protein 1; Fibrinogen-like protein 1; Hepassocin; Hepatocellular carcinoma related sequence; Hepatocyte derived fibrinogen related protein 1; Hepatocyte-derived fibrinogen-related protein 1; HFREP 1; HFREP-1; HFREP1; HP 041; HP-041; HP041; LFIRE 1; LFIRE-1; LFIRE1; Liver fibrinogen related protein 1; Liver fibrinogen-related protein 1; MFIRE 1; MGC108569; MGC12455; MGC37822; OTTHUMP00000122468

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

23-312aa

Target Protein Sequence

LEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

64.09999999999999

Protein Length

Full Length of Mature Protein

Tag Info

C-terminal hFc1-Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

To express the recombinant Human FGL1 protein in mammalian cells, a DNA fragment encoding the Human FGL1 protein (23-312aa) is inserted into a plasmid vector and transferred to the mammalian cells. Cells containing the plasmid are screened, cultured, and induced to express the FGL1 protein. The protein carries a C-terminal hFc-Myc tag. Lysing the cells allows for the collection of the recombinant Human FGL1 protein, which is purified through affinity purification and then identified through SDS-PAGE and subsequent staining of the gel with Coomassie Brilliant Blue. The purity of the recombinant Human FGL1 protein obtained is greater than 85%.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Immune suppressive molecule that inhibits antigen-specific T-cell activation by acting as a major ligand of LAG3. Responsible for LAG3 T-cell inhibitory function. Binds LAG3 independently from MHC class II (MHC-II). Secreted by, and promotes growth of, hepatocytes.

Gene References into Functions

FGL1 promotes invasion and metastasis of gastric cancer and is associated with poor prognosis. PMID: 29845203
findings highlight the crucial role of HFREP1 in insulin resistance and diabetes, and provide a potential strategy and biomarker for developing therapeutic approaches to combat these diseases. PMID: 27221093
Hepassocin plays an important role in non-alcoholic fatty liver disease and induces hepatic lipid accumulation through an ERK1/2-dependent pathway. PMID: 23792031
Here, the application of small ubiquitin-related modifier (SUMO) fusion technology in combination with four different chaperone teams on the soluble expression of recombinant HPS protein was explored and analyzed. PMID: 24084006
Findings suggest that hepassocin promotes hepatic cell line L02 cells proliferation via an autocrine mechanism and inhibits HCC cells proliferation by an intracrine pathway. PMID: 21618590
data demonstrated that liver-specific gene LFIRE-1/HFREP-1 was frequently downregulated and might possess growth suppressor activity in HCC PMID: 14981537
HFREP-1 in plasma almost completely bound to the fibrin matrix during clot formation PMID: 16996032
The enhancement of FGL1 levels in vitro by IL-6 and its induction after turpentine oil injection suggest that it is an acute phase reactant. PMID: 18039467
HNF1 binding site and HNF1alpha are critical to liver-specific expression of HPS, and down-regulation or loss of HNF1alpha causes, at least in part, the transcriptional down-regulation of HPS in HCC. PMID: 19304666