Recombinant Human Fibrinogen-like protein 1 (FGL1)

In Stock
Code CSB-MP008653HU
Abbreviation Recombinant Human FGL1 protein
MSDS
Size $138
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE
Target Names
FGL1
Uniprot No.
Research Area
Cardiovascular?
Alternative Names
FGL 1; Fgl1; FGL1_HUMAN; Fibrinogen like 1; Fibrinogen like protein 1; Fibrinogen related protein 1; Fibrinogen-like protein 1; Hepassocin; Hepatocellular carcinoma related sequence; Hepatocyte derived fibrinogen related protein 1; Hepatocyte-derived fibrinogen-related protein 1; HFREP 1; HFREP-1; HFREP1; HP 041; HP-041; HP041; LFIRE 1; LFIRE-1; LFIRE1; Liver fibrinogen related protein 1; Liver fibrinogen-related protein 1; MFIRE 1; MGC108569; MGC12455; MGC37822; OTTHUMP00000122468
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
23-312aa
Target Protein Sequence
LEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
64.1 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal hFc1-Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

To express the recombinant Human FGL1 protein in mammalian cells, a DNA fragment encoding the Human FGL1 protein (23-312aa) is inserted into a plasmid vector and transferred to the mammalian cells. Cells containing the plasmid are screened, cultured, and induced to express the FGL1 protein. The protein carries a C-terminal hFc-Myc tag. Lysing the cells allows for the collection of the recombinant Human FGL1 protein, which is purified through affinity purification and then identified through SDS-PAGE and subsequent staining of the gel with Coomassie Brilliant Blue. The purity of the recombinant Human FGL1 protein obtained is greater than 85%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Immune suppressive molecule that inhibits antigen-specific T-cell activation by acting as a major ligand of LAG3. Responsible for LAG3 T-cell inhibitory function. Binds LAG3 independently from MHC class II (MHC-II). Secreted by, and promotes growth of, hepatocytes.
Gene References into Functions
  1. FGL1 promotes invasion and metastasis of gastric cancer and is associated with poor prognosis. PMID: 29845203
  2. findings highlight the crucial role of HFREP1 in insulin resistance and diabetes, and provide a potential strategy and biomarker for developing therapeutic approaches to combat these diseases. PMID: 27221093
  3. Hepassocin plays an important role in non-alcoholic fatty liver disease and induces hepatic lipid accumulation through an ERK1/2-dependent pathway. PMID: 23792031
  4. Here, the application of small ubiquitin-related modifier (SUMO) fusion technology in combination with four different chaperone teams on the soluble expression of recombinant HPS protein was explored and analyzed. PMID: 24084006
  5. Findings suggest that hepassocin promotes hepatic cell line L02 cells proliferation via an autocrine mechanism and inhibits HCC cells proliferation by an intracrine pathway. PMID: 21618590
  6. data demonstrated that liver-specific gene LFIRE-1/HFREP-1 was frequently downregulated and might possess growth suppressor activity in HCC PMID: 14981537
  7. HFREP-1 in plasma almost completely bound to the fibrin matrix during clot formation PMID: 16996032
  8. The enhancement of FGL1 levels in vitro by IL-6 and its induction after turpentine oil injection suggest that it is an acute phase reactant. PMID: 18039467
  9. HNF1 binding site and HNF1alpha are critical to liver-specific expression of HPS, and down-regulation or loss of HNF1alpha causes, at least in part, the transcriptional down-regulation of HPS in HCC. PMID: 19304666

Show More

Hide All

Subcellular Location
Secreted.
Tissue Specificity
Under normal conditions, liver-specific.
Database Links

HGNC: 3695

OMIM: 605776

KEGG: hsa:2267

STRING: 9606.ENSP00000221204

UniGene: Hs.491143

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*