Code | CSB-EP008618HU |
Size | US$1726 |
Image |
Purity | Greater than 90% as determined by SDS-PAGE. |
Target Names | FGF12 |
Uniprot No. | P61328 |
Research Area | Cardiovascular |
Alternative Names | Fibroblast growth factor homologous factor 1 |
Species | Homo sapiens (Human) |
Source | E.coli |
Expression Region | 1-181aa |
Target Protein Sequence | MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 47.4kDa |
Protein Length | Full Length of Isoform 2 |
Tag Info | N-terminal GST-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. |
Datasheet & COA | Please contact us to get it. |
Still Have Questions? | Leave a Message or Start an on-line Chat |
Function | Involved in nervous system development and function. Involved in the positive regulation of voltage-gated sodium channel activity. Promotes neuronal excitability by elevating the voltage dependence of neuronal sodium channel SCN8A fast inactivation. |
Involvement in disease | Epileptic encephalopathy, early infantile, 47 (EIEE47) |
Subcellular Location | Nucleus |
Protein Families | Heparin-binding growth factors family |
Tissue Specificity | Brain, eye and testis; highly expressed in embryonic retina, olfactory epithelium, olfactory bulb, and in a segmental pattern of the body wall; in adult olfactory bulb, less in cerebellum, deep cerebellar nuclei, cortex and multiple midbrain structures. |
Database Links |
HGNC: 3668 OMIM: 601513 KEGG: hsa:2257 STRING: 9606.ENSP00000413496 UniGene: Hs.390250 |
Recombinant Mouse Thy-1 membrane glycoprotein(Thy1)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Human T cell receptor alpha constant(TRAC)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Odontogenic ameloblast-associated protein(ODAM)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Poly(A)-specific ribonuclease PARN(PARN)
Express system: E.coli
Species: Homo sapiens (Human)