Recombinant Human Fibroblast growth factor 12(FGF12)

Code CSB-EP008618HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P61328
Relevance Involved in nervous system development and function. Promote neuronal excitability by elevating the voltage dependence of neuronal sodium channel SCN8A fast inactivation.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Fibroblast growth factor homologous factor 1
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST
Research Area Cardiovascular
Source E.coli
Gene Names FGF12
Protein Names Recommended name: Fibroblast growth factor 12 Short name= FGF-12Alternative name(s): Fibroblast growth factor homologous factor 1 Short name= FHF-1 Myocyte-activating factor
Expression Region 1-181aa
Tag Info N-terminal GST-tagged
Mol. Weight 47.4kDa
Protein Description Full Length of Isoform 2
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in nervous system development and function. Involved in the positive regulation of voltage-gated sodium channel activity. Promotes neuronal excitability by elevating the voltage dependence of neuronal sodium channel SCN8A fast inactivation.
Involvement in disease Epileptic encephalopathy, early infantile, 47 (EIEE47)
Subcellular Location Nucleus
Protein Families Heparin-binding growth factors family
Tissue Specificity Brain, eye and testis; highly expressed in embryonic retina, olfactory epithelium, olfactory bulb, and in a segmental pattern of the body wall; in adult olfactory bulb, less in cerebellum, deep cerebellar nuclei, cortex and multiple midbrain structures.
Database Links

HGNC: 3668

OMIM: 601513

KEGG: hsa:2257

STRING: 9606.ENSP00000413496

UniGene: Hs.390250

Related Products

FGF12 Antibodies

FGF12 Antibodies for Homo sapiens (Human)

FGF12 Antibodies for Human

FGF12 Proteins

FGF12 Proteins for Homo sapiens (Human)

FGF12 ELISA Kit

FGF12 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.