Recombinant Human Fibroblast growth factor 12(FGF12) (Active)

In Stock
Code CSB-AP004021HU
Product Type Growth Factor
Size $104Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P61328
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, 5 mM EDTA, pH 7.5
Alias Fibroblast Growth Factor 12; FGF-12; Fibroblast Growth Factor Homologous Factor 1; FHF-1; Myocyte-Activating Factor; FGF12; FGF12B; FHF1
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined by its ability to bind Human FGF R3 in functional ELISA is less than 20 ug/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST
Research Area Cardiovascular
Source E.coli
Gene Names FGF12
Expression Region 1-181aa
Tag Info Tag-Free
Mol. Weight 20.45 kDa
Protein Description Full Length of Isoform?2
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in nervous system development and function. Involved in the positive regulation of voltage-gated sodium channel activity. Promotes neuronal excitability by elevating the voltage dependence of neuronal sodium channel SCN8A fast inactivation.
Involvement in disease Epileptic encephalopathy, early infantile, 47 (EIEE47)
Subcellular Location Nucleus
Protein Families Heparin-binding growth factors family
Tissue Specificity Brain, eye and testis; highly expressed in embryonic retina, olfactory epithelium, olfactory bulb, and in a segmental pattern of the body wall; in adult olfactory bulb, less in cerebellum, deep cerebellar nuclei, cortex and multiple midbrain structures.
Database Links

HGNC: 3668

OMIM: 601513

KEGG: hsa:2257

STRING: 9606.ENSP00000413496

UniGene: Hs.390250

Related Products

FGF12 Antibodies

FGF12 Antibodies for Homo sapiens (Human)

FGF12 Antibodies for Human

FGF12 Proteins

FGF12 Proteins for Homo sapiens (Human)

FGF12 ELISA Kit

FGF12 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.