Recombinant Human Fibromodulin (FMOD)

Code CSB-YP008755HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP008755HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP008755HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP008755HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP008755HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
FMOD
Uniprot No.
Alternative Names
Fibromodulin; FM; Collagen-binding 59 kDa protein; Keratan sulfate proteoglycan fibromodulin; KSPG fibromodulin; FMOD FM SLRR2E
Species
Homo sapiens (Human)
Expression Region
19-376
Target Protein Sequence
QYEDDPHWWFHYLRSQQSTYYDPYDPYPYETYEPYPYGVDEGPAYTYGSPSPPDPRDCPQECDCPPNFPTAMYCDNRNLKYLPFVPSRMKYVYFQNNQITSIQEGVFDNATGLLWIALHGNQITSDKVGRKVFSKLRHLERLYLDHNNLTRMPGPLPRSLRELHLDHNQISRVPNNALEGLENLTALYLQHNEIQEVGSSMRGLRSLILLDLSYNHLRKVPDGLPSALEQLYMEHNNVYTVPDSYFRGAPKLLYVRLSHNSLTNNGLASNTFNSSSLLELDLSYNQLQKIPPVNTNLENLYLQGNRINEFSISSFCTVVDVVNFSKLQVLRLDGNEIKRSAMPADAPLCLRLASLIEI
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Affects the rate of fibrils formation. May have a primary role in collagen fibrillogenesis.
Gene References into Functions
  1. The results of luciferase reporter assay and methylation-specific PCR (MSP) demonstrated that GDNF facilitated the demethylation of the FMOD promoter. PMID: 30176167
  2. crystal structures at ~2.2A resolution of human fibromodulin and chondroadherin. PMID: 28215822
  3. we found that secreted FMOD as an important regulator of glioma cell migration downstream of TGF-beta1 pathway and forms a potential basis for therapeutic intervention in GBM. PMID: 27212030
  4. The small leucine rich proteoglycan fibromodulin is overexpressed in human prostate epithelial cancer cell lines in culture and human prostate cancer tissue. PMID: 26600400
  5. expression levels distinguish chronic lymphocytic leukemia B cells from normal B lymphocytes PMID: 26318878
  6. The data suggest a fibromodulin-modulated collagen cross-linking mechanism where fibromodulin binds to a specific part of the collagen domain and also forms a complex with lysyl oxidase, targeting the enzyme toward specific cross-linking sites. PMID: 26893379
  7. fibromodulin is involved in the inflammatory processes that characterize atherosclerotic plaque vulnerability PMID: 26125412
  8. The results suggest that regions within FMOD is associated with ACL injury susceptibility and that genetic sequence variability within genes encoding proteoglycans may potentially modulate the ligament fibril properties. PMID: 24552666
  9. Melanocyte-secreted factor FMOD is a key regulator of angiogenesis. PMID: 24355922
  10. Associations between higher fibomodulin gene expression and risk factors in chronic lymphocytic leukemia. PMID: 22099931
  11. Hepatic fibromodulin activates hepatic stellate cells and promotes collagen I deposition, which leads to liver fibrosis. PMID: 22138190
  12. lumican and fibromodulin display different behaviors and that lumican may promote regeneration of the TMJ after degeneration and deformation induced by IL-1 beta. PMID: 22073367
  13. study shows (1) a detailed description of ectopic ossification (EO) formed by Bgn, Fmod or combined depletion, (2) the role of exercise in modulating EO and (3) that Bgn and Fmod are critical in controlling motor function. PMID: 19422643
  14. Fibromodulin is shown for the first time to be naturally processed and presented as a tumor-associated antigen in primary chronic lymphocytic leukemia cells, enabling the expansion of autologous tumor-specific T cells. PMID: 15471955
  15. Fibromodulin has a role in progression of B-cell chronic lymphocytic leukemia and mantle cell lymphoma PMID: 15741214
  16. fibromodulin activates the classical pathway of complement by directly binding C1q PMID: 16046396
  17. complement control protein 6-8 is able to interact with DNA and necrotic cells, but in contrast the His-384 allotype binds these ligands more strongly than the Tyr-384 variant PMID: 17293598
  18. The collagen-binding Glu-353 and Lys-355 residues in fibromodulin are exposed on the exterior of the beta-sheet-loop structure of the leucine-rich repeat, which resembles the location of interacting residues in other leucine-rich repeat proteins. PMID: 17623650
  19. Fibromodulin gene is constantly expressed in human epidermal keratinocytes. PMID: 18448071
  20. Specific decorin and fibromodulin core protein fragments in degenerate meniscus and/or human articular cartilage may be of value as biomarkers of disease. PMID: 18620607
  21. CD200 blockade was further shown to stimulate antigen-specific T cell responses towards the CLL-associated antigen fibromodulin PMID: 18838168
  22. Homologous sequence in lumican and fibromodulin leucine-rich repeat 5-7 competes for collagen binding. PMID: 19008226
  23. Ultraviolet B and A irradiation induce FMOD expression in fibroblasts in vitro. PMID: 19041686
  24. differentially expressed in mesenchymal stromal cell subset with reduced differentiation potential PMID: 19242838
  25. tyrosine sulfate-rich domains of the LRR proteins fibromodulin and osteoadherin bind motifs of basic clusters in a variety of heparin-binding proteins, including bioactive factors PMID: 19700767

Show More

Hide All

Subcellular Location
Secreted, extracellular space, extracellular matrix.
Protein Families
Small leucine-rich proteoglycan (SLRP) family, SLRP class II subfamily
Database Links

HGNC: 3774

OMIM: 600245

KEGG: hsa:2331

STRING: 9606.ENSP00000347041

UniGene: Hs.519168

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1