Recombinant Human Fibronectin type III domain-containing protein 5 (FNDC5), partial

In Stock
Code CSB-EP836707HU
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
FNDC5
Uniprot No.
Research Area
Cell Biology
Alternative Names
Fibronectin type III domain containing 5; Fibronectin type III domain-containing protein 5; Fibronectin type III repeat containing protein 2; Fibronectin type III repeat-containing protein 2; FNDC 5; Fndc5; FNDC5_HUMAN; FRCP2; irisin
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
32-143aa
Target Protein Sequence
DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
28.6kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant human fibronectin type III domain-containing protein 5 (FNDC5) is produced in E.coli with the gene fragment corresponding to amino acids 32-143 of the human FNDC5. It is fused with a 6xHis-SUMO tag at the N-terminus. The 6xHis-SUMO motif is conducive to the generation of high-yield soluble, functional recombinant protein. The purity of this recombinant FNDC5 protein is greater than 90% measured by SDS-PAGE. It migrated to the molecular weight band of about 33 kDa on the gel. The target protein FNDC5 is a glycosylated type I membrane protein that produces a myokine irisin in response to exercise. Irisin travels to white adipose tissue and induces browning.

Customer Reviews and Q&A

 Customer Reviews
Average Rating:
5.0 - 2 reviews

Submit a Review here

Applications : Pump Implantation

Review: The pump was filled with 150 μL of 0.25 μg/μL recombinant human fibronectin type III domain-containing protein 5 (FNDC5) (CusaBio, Houston, TX, USA) reconstituted with PBS.

By Anonymous

Applications : / Sample species: cells

Review: Animals were acclimated and then separated into two groups (n = 10): a sham group receiving a bare surgery and another receiving an ALZET Osmotic Pump 2006, loaded with recombinant human irisin (FNDC5) (CusaBio, Houston, TX, USA) at a concentration of 0.25 µg/µL.

By Anonymous

Target Background

Function
Contrary to mouse, may not be involved in the beneficial effects of muscular exercise, nor in the induction of browning of human white adipose tissue.
Gene References into Functions
  1. Lower levels of irisin were associated with 1.6 times increased cardiovascular disease risk. PMID: 29673927
  2. There is a decrease in serum irisin level in type 2 diabetic patients with even more significant reduction in patients with diabetic nephropathy. PMID: 28875825
  3. FNDC5 mRNA expression in skeletal muscle and circulating irisin concentration relatively to exercise mode, intensity, frequency and duration and the characteristics of the sample used PMID: 29127759
  4. Serum concentrations of irisin are elevated in post-myocardial infarction patients with increased risk for adverse cardiovascular events. PMID: 29657036
  5. Acute high-intensity interval exercise decreased irisin levels and increased myostatin levels. PMID: 29558345
  6. serum levels were significantly lower in pre-eclampsia than normotensive pregnancies PMID: 29430974
  7. Glucocorticoid receptor positively regulates transcription of FNDC5 in the liver. PMID: 28240298
  8. This study finds that soccer matches performed different workout times have strong stimulatory effects on irisin levels in all subjects but nesfatin-1 response varied among the subjects and it did not change significantly in afternoon match. PMID: 30084805
  9. Results show that Irisin concentration in umbilical cord blood was found to be associated with preterm birth (PTB). On the other hand, no differences in maternal blood irisin levels between mothers with preterm and term deliveries were established. PMID: 29997715
  10. Irisin concentrations do not predict risk of developing diabetes prospectively PMID: 29108900
  11. serum irisin levels were significantly lower in patients with psoriasis, and associated with serum lipid levels and disease activity; these results can be interpreted that irisin is involved in the disease pathogenesis of patients with psoriasis in relation to metabolic dysregulation PMID: 27652568
  12. This study show the serum irisin levels had significant positive correlation with seizure severity Chalfont score and the duration of epilepsy. PMID: 29860632
  13. clinical evidence of the association between serum irisin and vascular calcification in HD patients PMID: 29490308
  14. The pooled data indicated that the levels of irisin were at least 45.78 ng/ml higher in patients with polycystic ovary syndrome than that in the healthy controls. The current meta-analysis suggested that irisin might contribute to the development of PCOS independent of insulin resistance. PMID: 29069945
  15. With adjustment for body mass index, circulating irisin in polycystic ovary syndrome patients seems comparable to healthy controls. [meta-analysis] PMID: 29217128
  16. serum irisin levels were lower in Peritoneal Dialysis patients with Protein Energy Wasting than those of the patients without PEW PMID: 29248911
  17. Data suggest that decreased irisin levels are associated with metabolic syndrome in prepubertal children; irisin may be a biomarker for metabolic syndrome in prepubertal children. This study was conducted in Seoul, Republic of Korea. PMID: 28904307
  18. Findings revealed that irisin may play a critical role in the IL-6-induced epithelialmesenchymal transition of osteosarcoma cells via the STAT3/Snail signaling pathway. PMID: 29048621
  19. FNDC5 gene interactions with candidate genes FOXOA3 and APOE PMID: 29143599
  20. Irisin is negatively associated with serum testosterone in apopulation sample of men with Metabolic syndrome. PMID: 28759938
  21. Irisin replenishment in mCaROCK1 mice partially reversed insulin resistance. PMID: 27411515
  22. Suggest that irisin exerts beneficial effect on mood in COPD patients, possibly by inducing the expression of BDNF in brain areas associated with reward-related processes involved in by depression. PMID: 28744117
  23. Modulation of Irisin and Physical Activity on Executive Functions in Obesity and Morbid obesity. PMID: 27476477
  24. Obese children had significantly higher irisin and lower oxytocin levels than the healthy controls. PMID: 28077341
  25. We determined FNDC5 polymorphisms frequencies in the Israeli population and demonstrated that maternal and neonatal FNDC5 rs726344 polymorphism is significantly associated with increased risk for preterm birth. Women bearing FNDC5 rs726344 GG genotype had 2.18 fold higher chance to deliver on time compared to AG and AA genotypes.Neonatal carrying FNDC5 rs726344 GG genotype had 2.24 fold higher chance to be born on time. PMID: 29408625
  26. Lower levels of irisin are independently associated with elevated skin AF values, indicating that circulating irisin levels could be associated with AGEs accumulation, which is one of the reasons causing vascular complications in diabetic patients. PMID: 28408433
  27. Association of Irisin Plasma Levels with Anthropometric Parameters in Children with Underweight, Normal Weight, Overweight, and Obesity. PMID: 28553647
  28. irisin was significantly higher in obese than in control children, and was inversely correlated with Acrp30 and high molecular weight (HMW) oligomers; inverse correlation between Irisin and Acrp30 and, more significantly, between Irisin and HMW oligomers suggests that the two cytokines are closely connected PMID: 28385328
  29. Irisin is an oxidative stress marker and a metabolic protective hormone. PMID: 28277125
  30. Mild cold exposure increased vasoconstriction with a drop in in-the-ear temperature and these were related. Greater irisin was related to a greater fasting fat oxidation in the absence of shivering PMID: 27006247
  31. Activation of the nuclear receptor constitutive androstane receptor (CAR) induced FNDC5 mRNA expression in the liver. PMID: 27007446
  32. HCC-liver tissue over-expressed FNDC5/Irisin in association with gene expression of mediators involved in lipogenesis, inflammation and cancer, suggesting a possible protective role of the hormone from the liver damage. PMID: 28012856
  33. The secretion of FNDC5 from myotubes and beta-cells in response to exogenous fatty acids, the effects of recombinant FNDC5 on insulin biosynthesis and glucose-stimulated insulin secretion, and beta-cell apoptosis are reported. PMID: 28724742
  34. Irisin regulates the number and function of endothelial progenitor cells via the PI3K/Akt/eNOS pathway in mouse model of diabetes mellitus. PMID: 27002278
  35. there is a correlation between sport performance, insulin sensitivity, and irisin levels PMID: 28386566
  36. results firstly revealed that irisin mitigated oxygen-glucose deprivation-induced neuronal injury in part via inhibiting ROS-NLRP3 inflammatory signaling pathway, suggesting a likely mechanism for irisin-induced therapeutic effect in ischemic stroke. PMID: 28961497
  37. These data indicate that increased irisin levels may have protective roles in liver cancer cells through partial activation of the PI3K/AKT pathway, which may facilitate liver cancer progression and decrease the sensitivity to chemotherapy. PMID: 28867187
  38. Decreased serum irisin levels are related to emphysema in patients with COPD and involved in epithelial apoptosis, resulting in emphysema. PMID: 28424548
  39. Irisin levels are lower in MI and CAD implying that their production may depend on myocardial blood supply. PMID: 28732565
  40. findings suggest that irisin plays an important role in metabolic disorders and may be affected by physiopathological status. PMID: 28732566
  41. The FNDC5 rs3480 variant is associated with protection from clinically significant fibrosis in patients with NAFLD, while irisin expression is correlated with the severity of NAFLD and may be involved in extracellular matrix deposition. These data suggest that irisin is involved in regulation of hepatic fibrogenesis. PMID: 28472477
  42. The median irisin levels were determined higher in T1DM group compared to the control one. PMID: 28222023
  43. The modulation of body composition and muscle strength induced by 16-week of resistance training in older women with and without obesity is not associated with changes in circulating Irisin levels. PMID: 28244561
  44. serum irisin levels were correlated with anthropometric and metabolic markers of obesity and type 2 diabetes mellitus . PMID: 27220658
  45. Plasma irisin modestly increases during moderate and high-intensity afternoon exercise in obese females. PMID: 28125733
  46. correlation between irisin and adiposity related factors suggests that that in the case of this clinical model, irisin is regulated by adiposity and not by GH PMID: 27472279
  47. Collectively, our study identified serum irisin as a predictive biomarker for 1-year all-cause mortality in acute heart failure patients though large multicenter studies are highly needed. PMID: 28595171
  48. T2DM and diabetic nephropathy are associated with decreased levels of irisin. FNDC5 rs16835198 TT genotype associates with decreased risk of T2DM in Egyptians with no effect on renal complications. Also, G allele has insulin desensitizing action with no association with circulating irisin levels. PMID: 28479383
  49. irisin might serve as a possible signal for linking body fat/muscle mass with the hypothalamic center governing reproductive function PMID: 27692156
  50. Results indicate that cytokines might predict irisin concentration in mothers and their offspring. PMID: 27828992

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein. Peroxisome membrane; Single-pass type I membrane protein.; [Irisin]: Secreted.
Tissue Specificity
Widely expressed, with highest levels in heart. Very low expression, if any, in colon, pancreas and spleen.
Database Links

HGNC: 20240

OMIM: 611906

KEGG: hsa:252995

STRING: 9606.ENSP00000362570

UniGene: Hs.524234

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*