Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

FTCD

Uniprot No.

O95954

Research Area

Others

Alternative Names

(Formiminotransferase-cyclodeaminase)(FTCD)(LCHC1)

Species

Homo sapiens (Human)

Source

Yeast

Expression Region

1-541aa

Target Protein Sequence

MSQLVECVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVASRLIDMSRHQGEHPRMGALDVCPFIPVRGVSVDECVLCAQAFGQRLAEELDVPVYLYGEAARMDSRRTLPAIRAGEYEALPKKLQQADWAPDFGPSSFVPSWGATATGARKFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKNLAQVSTNLLDFEVTALHTVYEETCREAQELSLPVVGSQLVGLVPLKALLDAAAFYCEKENLFILEEEQRIRLVVSRLGLDSLCPFSPKERIIEYLVPERGPERGLGSKSLRAFVGEVGARSAAPGGGSVAAAAAAMGAALGSMVGLMTYGRRQFQSLDTTMRRLIPPFREASAKLTTLVDADAEAFTAYLEAMRLPKNTPEEKDRRTAALQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

60 kDa

Protein Length

Full Length

Tag Info

C-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Amino acids 1-541 form the expressed segment for recombinant Human FTCD. This FTCD protein is expected to have a theoretical molecular weight of 60 kDa. This protein is generated in a yeast-based system. The FTCD gene fragment has been modified by fusing the C-terminal 6xHis tag, providing convenience in detecting and purifying the recombinant FTCD protein during the following stages.

Human Formimidoyltransferase-Cyclodeaminase (FTCD) is a bifunctional enzyme involved in the histidine catabolic pathway. It consists of two domains: the formiminotransferase domain and the cyclodeaminase domain. In the formiminotransferase reaction, FTCD catalyzes the transfer of the formimino group from N-formimino-L-glutamate to tetrahydrofolate, producing formate and 5,10-methenyltetrahydrofolate. In the cyclodeaminase reaction, FTCD converts formiminoglutamate to formamide and ammonia. This enzyme plays a crucial role in maintaining histidine homeostasis and folate metabolism. Research on FTCD includes exploring its role in disorders related to histidine metabolism, understanding its impact on folate utilization, and investigating its potential implications in human health and diseases.

Target Background

Function

Folate-dependent enzyme, that displays both transferase and deaminase activity. Serves to channel one-carbon units from formiminoglutamate to the folate pool.; Binds and promotes bundling of vimentin filaments originating from the Golgi.

Gene References into Functions

The formiminotransferase-cyclodeaminase allelic spectrum comprised of 12 distinct variants including 5 missense alterations, an in-frame deletion, two frameshift variants and four nonsense variants with the remaining alterations predicted to affect mRNA processing/stability. PMID: 29178637
FTCD is a positive regulator of the hypoxia-HIF signaling pathway and has an important role in cell proliferation, metabolism and migration in HepG2 cells PMID: 24686083
The FTCD promoter is activated by serum depletion according to promoter reporter assays in HEK 293 cells. PMID: 20494980
Scyl1 interacts with 58K/formiminotransferase cyclodeaminase (FTCD) and golgin p115, and is required for the maintenance of Golgi morphology PMID: 20209057
Disease-causing mutations have been identified in the FTCD gene in three patients with the putative autosomal recessive disorder glutamate formiminotransferase deficiency. PMID: 12815595

Hide All

Involvement in disease

Glutamate formiminotransferase deficiency (FIGLU-URIA)

Subcellular Location

Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole. Golgi apparatus. Note=More abundantly located around the mother centriole.

Protein Families

Cyclodeaminase/cyclohydrolase family; Formiminotransferase family

Database Links

HGNC: 3974

OMIM: 229100

KEGG: hsa:10841

STRING: 9606.ENSP00000291670

UniGene: Hs.415846

Code	CSB-YP009029HU
Abbreviation	Recombinant Human FTCD protein
MSDS	MSDS Datasheet
Size	$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Formimidoyltransferase-cyclodeaminase (FTCD)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage