Recombinant Human Fragile X mental retardation 1 neighbor protein (FMR1NB), partial

In Stock
Code CSB-EP839771HU
Abbreviation Recombinant Human FMR1NB protein, partial
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
FMR1NB
Uniprot No.
Research Area
Cancer
Alternative Names
Cancer/testis antigen 37; CT37; FLJ25736; FMR1N_HUMAN; FMR1NB; Fragile X mental retardation 1 neighbor; Fragile X mental retardation 1 neighbor protein; NY SAR 35; NYSAR35; Sarcoma antigen NY-SAR-35
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
90-183aa
Target Protein Sequence
LCSGSSYFVLANGHILPNSENAHGQSLEEDSALEALLNFFFPTTCNLRENQVAKPCNELQDLSESECLRHKCCFSSSGTTSFKCFAPFRDVPKQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
15.4 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Constructing a plasmid that codes for the Human FMR1NB protein (90-183aa) is the initial step to yield the recombinant Human FMR1NB protein. The plasmid is then transferred into e.coli cells. Positive e.coli cells are selected and cultured for the protein expression. A N-terminal 10xHis tag and C-terminal Myc tag is fused to the protein. The affinity purification is used to purify the protein, and SDS-PAGE analysis is carried out to verify the presence and assess the purity of the protein. The protein possesses a purity exceeding 85%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions
  1. NY-SAR-35 serves as a novel prognostic biomarker and therapeutic target for glioma. PMID: 29793325
  2. used a next generation sequencing (NGS) approach. NY-SAR-35 expression induced growth, proliferation, metastasis, and stemness genes, as indicated by the up-regulations of CXCR4, EpCAM, CD133, and CD44, at the mRNA and protein levels PMID: 28126340
  3. NY-SAR35 was predominantly expressed at the cytoplasm. PMID: 26648093
  4. The analysis of methylation status of the NY-SAR-35 gene promoter in various cancer cell lines showed that its expression was related to methylation of the promoter region. PMID: 21318630
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Testis-specific. Expressed in melanoma, sarcoma, lung, breast, bladder, esophageal and ovarian cancers.
Database Links

HGNC: 26372

KEGG: hsa:158521

STRING: 9606.ENSP00000359498

UniGene: Hs.128580

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*