Home
Protein
Recombinant Proteins
Recombinant Human Fragile X mental retardation 1 neighbor protein (FMR1NB), partial

Recombinant Human Fragile X mental retardation 1 neighbor protein (FMR1NB), partial

^{In Stock}

Code	CSB-EP839771HU
Abbreviation	Recombinant Human FMR1NB protein, partial
MSDS	MSDS Datasheet
Size	US$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

FMR1NB

Uniprot No.

Q8N0W7

Research Area

Cancer

Alternative Names

Cancer/testis antigen 37; CT37; FLJ25736; FMR1N_HUMAN; FMR1NB; Fragile X mental retardation 1 neighbor; Fragile X mental retardation 1 neighbor protein; NY SAR 35; NYSAR35; Sarcoma antigen NY-SAR-35

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

90-183aa

Target Protein Sequence

LCSGSSYFVLANGHILPNSENAHGQSLEEDSALEALLNFFFPTTCNLRENQVAKPCNELQDLSESECLRHKCCFSSSGTTSFKCFAPFRDVPKQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

15.4 kDa

Protein Length

Partial

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer,50% glycerol

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Constructing a plasmid that codes for the Human FMR1NB protein (90-183aa) is the initial step to yield the recombinant Human FMR1NB protein. The plasmid is then transferred into e.coli cells. Positive e.coli cells are selected and cultured for the protein expression. A N-terminal 10xHis tag and C-terminal Myc tag is fused to the protein. The affinity purification is used to purify the protein, and SDS-PAGE analysis is carried out to verify the presence and assess the purity of the protein. The protein possesses a purity exceeding 85%.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions

NY-SAR-35 serves as a novel prognostic biomarker and therapeutic target for glioma. PMID: 29793325
used a next generation sequencing (NGS) approach. NY-SAR-35 expression induced growth, proliferation, metastasis, and stemness genes, as indicated by the up-regulations of CXCR4, EpCAM, CD133, and CD44, at the mRNA and protein levels PMID: 28126340
NY-SAR35 was predominantly expressed at the cytoplasm. PMID: 26648093
The analysis of methylation status of the NY-SAR-35 gene promoter in various cancer cell lines showed that its expression was related to methylation of the promoter region. PMID: 21318630

Subcellular Location

Membrane; Multi-pass membrane protein.

Tissue Specificity

Testis-specific. Expressed in melanoma, sarcoma, lung, breast, bladder, esophageal and ovarian cancers.

Database Links

HGNC: 26372

KEGG: hsa:158521

STRING: 9606.ENSP00000359498

UniGene: Hs.128580

Promotions