Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

C6orf144

Uniprot No.

Q6UXV0

Research Area

Cell Biology

Alternative Names

bA360D14.1; C6orf144; GDNF family receptor alpha-like; Gfral; GFRAL_HUMAN; GRAL; IVFI9356; UNQ9356; UNQ9356/PRO34128

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

19-351aa

Target Protein Sequence

SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

53.8kDa

Protein Length

Extracellular Domain

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The region for expressing recombinant Human GFRAL contains amino acids 19-351. This GFRAL protein is theoretically predicted to have a molecular weight of 53.8 kDa. Expression of this GFRAL protein is conducted in e.coli. Fusion of the N-terminal 6xHis-SUMO tag into the GFRAL encoding gene fragment was conducted, allowing for easier detection and purification of the GFRAL protein in subsequent stages.

Human GDNF family receptor alpha-like (GFRAL) is a receptor associated with energy homeostasis. GFRAL mainly functions to mediate the effects of the GDNF family ligands on appetite regulation and body weight. Investigating GFRAL provides insights into neuroendocrine signaling, metabolic disorders, and cancer-related wasting, offering potential applications in developing interventions for obesity, metabolic diseases, and cancer-associated cachexia. In metabolic research, GFRAL is crucial for understanding mechanisms underlying obesity and metabolic disorders. Targeting GFRAL presents a potential avenue for developing anti-obesity therapeutics. Additionally, GFRAL's role in cancer cachexia implicates it in cancer research.

Target Background

Function

Brainstem-restricted receptor for GDF15 which regulates food intake, energy expenditure and body weight in response to metabolic and toxin-induced stresses. Upon interaction with its ligand, GDF15, interacts with RET and induces cellular signaling through activation of MAPK- and AKT- signaling pathways.

Subcellular Location

Cell membrane; Single-pass membrane protein; Extracellular side.

Protein Families

GDNFR family

Tissue Specificity

Expressed in the brainstem, restricted to cells in the area postrema and the immediately adjacent region of the nucleus tractus solitarius (at protein level). Detected at low levels in testis and adipose tissue.

Database Links

HGNC: 32789

OMIM: 617837

KEGG: hsa:389400

STRING: 9606.ENSP00000343636

UniGene: Hs.526967

Code	CSB-EP751020HU
Abbreviation	Recombinant Human GFRAL protein, partial
MSDS	MSDS Datasheet
Size	US$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human GDNF family receptor alpha-like (GFRAL), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage