Recombinant Human GDNF family receptor alpha-like (GFRAL), partial

In Stock
Code CSB-EP751020HU
Abbreviation Recombinant Human GFRAL protein, partial
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
C6orf144
Uniprot No.
Research Area
Cell Biology
Alternative Names
bA360D14.1; C6orf144; GDNF family receptor alpha-like; Gfral; GFRAL_HUMAN; GRAL; IVFI9356; UNQ9356; UNQ9356/PRO34128
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
19-351aa
Target Protein Sequence
SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
53.8kDa
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The region for expressing recombinant Human GFRAL contains amino acids 19-351. This GFRAL protein is theoretically predicted to have a molecular weight of 53.8 kDa. Expression of this GFRAL protein is conducted in e.coli. Fusion of the N-terminal 6xHis-SUMO tag into the GFRAL encoding gene fragment was conducted, allowing for easier detection and purification of the GFRAL protein in subsequent stages.

Human GDNF family receptor alpha-like (GFRAL) is a receptor associated with energy homeostasis. GFRAL mainly functions to mediate the effects of the GDNF family ligands on appetite regulation and body weight. Investigating GFRAL provides insights into neuroendocrine signaling, metabolic disorders, and cancer-related wasting, offering potential applications in developing interventions for obesity, metabolic diseases, and cancer-associated cachexia. In metabolic research, GFRAL is crucial for understanding mechanisms underlying obesity and metabolic disorders. Targeting GFRAL presents a potential avenue for developing anti-obesity therapeutics. Additionally, GFRAL's role in cancer cachexia implicates it in cancer research.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Brainstem-restricted receptor for GDF15 which regulates food intake, energy expenditure and body weight in response to metabolic and toxin-induced stresses. Upon interaction with its ligand, GDF15, interacts with RET and induces cellular signaling through activation of MAPK- and AKT- signaling pathways.
Subcellular Location
Cell membrane; Single-pass membrane protein; Extracellular side.
Protein Families
GDNFR family
Tissue Specificity
Expressed in the brainstem, restricted to cells in the area postrema and the immediately adjacent region of the nucleus tractus solitarius (at protein level). Detected at low levels in testis and adipose tissue.
Database Links

HGNC: 32789

OMIM: 617837

KEGG: hsa:389400

STRING: 9606.ENSP00000343636

UniGene: Hs.526967

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*